GENSCAN 1.0	Date run: 14-Jan-104	Time: 23:18:55

Sequence OPTN_1 : 39514 bp : 42.53% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1238   1334   97  0  1   92   99    63 0.861   5.95
ggcagggtgggggggatgggcggggtatgggatgggcggggcccgggaaattccccggcg
cgggcagggagcggctggctgtcagctgagccgcgctgggcggggtcgccaggccgcgca
tcagccctaggcaccccagtcccggctgccccctccgccaccgccgccgcccgccggcag
GTTCCCTGGTCAGCGTCCCATCCCGGTCGGGAGTTCTCTCCAGGCGGCACGATGCCGAGG
AAACAGTGACCCTGAGCGAAGCCAAGCCGGGCGGCAG
gtgagccagggcagggggctgcagcggtgggcgagggggcggcggctccttcccggcggg
cgcttccgcggcctgaaaacggtacccgccgccctgccccgcggcccggagcctgtcggg
gtgagggtggcgaggggtggggcggccctcccgcgagacggctgccctgggaggatcccc

 1.02 Intr +   1658   1764  107  2  2   28   52   118 0.836   1.14
ggccctcccgcgagacggctgccctgggaggatccccaagcctcggcgggtcctgacctg
gtgggagagggtgggtagtgaacacagggtgggcccaagaagggtccagggccggcctct
tggccgcaggtaacccctctacaagtcacccagagacttggaggtgacgtcctcccgcag
GCTGGGAAGGATTCCGCAGCCAGTTCCTCGCCATAAGGAGGTGGTTACAGACACGCCTGT
GGGAGACATGGGACCACTACCCGAGCTGAATGAGGTGCCCAGGGTCG
gtgggaatccacatagactgctgtgtctaggagagtgtgtacactctatatagagagaat
atttgatgaggccgagaaccccaaaggaattgtttttgccatcgaaatgcataagctaca
ggaagtaaacatcgctcaaagaaaatgaaacccaggttccgacctggcctccaccagcag

 1.03 Intr +   5809   5947  139  2  1   86   46    91 0.384   3.30
aggatactgtttcctcgtattaccaccattccagtattgttctgttgcccactagtcgcc
atctccacacattcatctatcacaagattcataaagggatcaagtccctgcaatattcct
tggacgtgtctgccaccatttaatttcaatgataacttcttgtccataaatcccttctag
CCATCTGGTTAGAACATGATGCTATTCGAGATGTTCAACAAAAGGTGGCATTCGAGATCT
TCAAGGAACGAAGAAGGGACAGCATGGGGGTGACCAGGGGCCCGACCGCAGGACCGGGAG
GCGAGTCGGCCAGAAAGAG
gtgcagtggctgctggtggtaactacgccgacgtgcgagctctgctactaatttatgtat
ttttagtagagatgggatttcaccatgttggctgggctgatctcaaactcctggcctcaa
atgatctgcccaccttggcttcccaaagtgctgggattacaggcataagccactgcaccc

 1.04 Intr +  10175  10320  146  2  2   48  105   239 0.370  20.61
aagaatcaaaaatgtccaaaatgtaactggagagaaagtgggcaacttttggagtaagta
ttagcaatcgccaatgggtttgtgggactcccggggaccccttgtggggcgggggacagc
tctattttcaacaggtgacttttccacaggaacttctgcaatgtcccatcaacctctcag
CTGCCTCACTGAAAAGGAGGACAGCCCCAGTGAAAGCACAGGAAATGGACCCCCCCACCT
GGCCCACCCAAACCTGGACACGTTTACCCCGGAGGAGCTGCTGCAGCAGATGAAAGAGCT
CCTGACCGAGAACCACCAGCTGAAAG
gtgagcagggctggcccctgtgtgccccattcatcctgggcctgcaagaaatgccatccc
tttgcactaaggcttggtggtgagctcccttctccccgtttccataggtggtagctggtg
gggaagcacaggatttagcatttggcaaggctaaatctgttctgatttttacttttggaa

 1.05 Intr +  11306  11508  203  0  2   72   83   247 0.998  20.68
gctagtcttttctgtaagcaaaaaccacttcgtctttttgctgctgacccttgggccaag
gctaagcatggcatctttcaattcagagccatgtggtcaagtggactagagggagatttg
gttcatcagatcaagtccactttcctggtgtgtgactccatcactctgaacctcctgcag
AAGCCATGAAGCTAAATAATCAAGCCATGAAAGGGAGATTTGAGGAGCTTTCGGCCTGGA
CAGAGAAACAGAAGGAAGAACGCCAGTTTTTTGAGATACAGAGCAAAGAAGCAAAAGAGC
GTCTAATGGCCTTGAGTCATGAGAATGAGAAATTGAAGGAAGAGCTTGGAAAACTAAAAG
GGAAATCAGAAAGGTCATCTGAG
gtgagcagaccgatccattgtgatgttgttttttttttttcccttgacatttgcagtgga
atcttacgtgtctagactcctagatcaaaacctttcatggttcagtctggattggtgttt
tgcctggtcttggaagaagtgcttttgctgaaaagattggttgccctattaagggtcatg

 1.06 Intr +  13485  13667  183  2  0  107   68   239 0.999  22.86
aattattaaattttttgtaaagatgggggtcttgctatgttgcccaggctggtctcaaaa
tcctggcctcaagggatcctcccacttcagcctcccagagctctgcgattaagggcatga
gcccatggtgcccagccttagtttgatctgttcattcactttactccttgtcatctccag
GACCCCACTGATGACTCCAGGCTTCCCAGGGCCGAAGCGGAGCAGGAAAAGGACCAGCTC
AGGACCCAGGTGGTGAGGCTACAAGCAGAGAAGGCAGACCTGTTGGGCATCGTGTCTGAA
CTGCAGCTCAAGCTGAACTCCAGCGGCTCCTCAGAAGATTCCTTTGTTGAAATTAGGATG
GCT
gtgagtttttggttttatttttgttttgagcaaactataaagcctcccctggaaagatga
aacaaataccactttttcttgtcaacacaagccaaggattgaggaaattccagtgtagca
aagataaattggctctcattttctaagtatagcataatgcatgtaagggttatcatagct

 1.07 Intr +  17299  17372   74  0  2  104   60    52 0.722   1.29
ggggagggtacgtttccatttcctctgagccaccccgtttaaacagtgcacatctgaatg
tttggaagcttccttgggttgcatgtcacaaaaattcatcttttgtctttttcttctttt
gacaaagaatttgtcttgtagacatattgtgttaaatcccttgcatttctgttttcacag
GAAGGAGAAGCAGAAGGGTCAGTAAAAGAAATCAAGCATAGTCCTGGGCCCACGAGAACA
GTCTCCACTGGCAC
gtatgtgaaggaagactcgggctgtcaggcagacaggctgggcaggctcgtcactgggtg
cttgtcaccggaggtcaaatgttgtgacctgaggaagtaacttctttatgatttatacca
ggatctttccagaatatttggtttgaatgctatttaatgttgcagctcaaactggcaaag

 1.08 Intr +  19920  20072  153  0  0   58   86   114 0.565   6.47
catggaggagcttggcactgggggtcccaggaccagctgtgcttgttcactagttgagaa
ttagttggagaatgttctggaaagcagttcctttaagctggtcccagttatattgggtta
ctctcttcttagtctttggaatttttctgatgaaaaccttttaacctttatactgaacag
GGCATTGTCTAAATATAGGAGCAGATCTGCAGATGGGGCCAAGAATTACTTCGAACATGA
GGAGTTAACTGTGAGCCAGCTCCTGCTGTGCCTAAGGGAAGGGAATCAGAAGGTGGAGAG
ACTTGAAGTTGCACTCAAGGAGGCCAAAGAAAG
gtatgaaataggttaacttgaaatatgtgtttttttaaaacagctttcctgagatataat
taagataccatacagttcacccatttaaagtatacatttcagtgttttttagaatattcc
aggattgtgcaaccactgttactacaatataattttagaacattttttcccccaaacagc

 1.09 Intr +  23417  23519  103  2  1   70   74   155 0.999  11.56
tagccaattttaggatgaaaaataaaactaatgctaatatagtgaatgtgtagagatttt
gaaaacccctgatcctttatcccaattgtaaacaatgttctttttagtacttctgtaata
attgctatttctcttaaagccaaagagaaagtaacttttctatcttctgtgattttccag
AGTTTCAGATTTTGAAAAGAAAACAAGTAATCGTTCTGAGATTGAAACCCAGACAGAGGG
GAGCACAGAGAAAGAGAATGATGAAGAGAAAGGCCCGGAGACT
gtgagtcctaagattccacggccactaccacacccacacacacgagagtagtccagccac
tgaattcaaatcttgtgatgggttatttgctttagaaatatagaaatcatgttgatattg
aatattatctatctattccttttatatgtccttgtcctgctctgtgtcaattgtagcgag

 1.10 Intr +  25027  25142  116  0  2   46   69   132 0.997   5.43
aagtaccaagtatccaaaacattcttttcctacacaatgtttggggtattgtcaaagttg
gattgattcaccagccagtcttaattggctactaatggttcagcctgttttctcctaaag
aggtttgtttaatgtcagatgataattgtacagatatgtttgggatttcccgtatgatag
GTTGGAAGCGAAGTGGAAGCACTGAACCTCCAGGTGACATCTCTGTTTAAGGAGCTTCAA
GAGGCTCATACAAAACTCAGCAAAGCTGAGCTAATGAAGAAGAGACTTCAAGAAAA
gtaagaatgagagagcaattttatcctcctttgaaatatacatttttacaaagtatacta
ctatataaaaacatagttttttaactatgttatgactaaaagaaaaatagacacctaatt
aaaatataaattcagaatatactaatgttccagttaatgtgtgagcatgaaatacttgta

 1.11 Intr +  26450  26599  150  2  0   66   87   139 0.998   9.96
agggttcagaaatatggccaggtctagtgaagaagcaaggaggattatgtatttcatttt
gcattcataaaccctacagccctaaaattcttatattgtacataaccttggggtttgttt
aaaagccactgcgacgtaaaggagcattgtttatcctcatgaaatcttgacctttcttag
GTGTCAGGCCCTTGAAAGGAAAAATTCTGCAATTCCATCAGAGTTGAATGAAAAGCAAGA
GCTTGTTTATACTAACAAAAAGTTAGAGCTACAAGTGGAAAGCATGCTATCAGAAATCAA
AATGGAACAGGCTAAAACAGAGGATGAAAA
gtgagtatgttgagtcagaagggcagcgacggggcagaggagggagaatcgcctttttat
acagattggaattcggatttgagaataaattttaaaaaatttctttttcacttatctgaa
ggagtcctagcagacctctcagagagggggataaaatttaaaagttttgtcataataaaa

 1.12 Intr +  26978  27071   94  2  1   73   51    59 0.939  -0.25
ctctgtcttgatttttcagaaaagattttttttgagagtaagaaatgctagtaggtcgtg
gggtgataaaggtaggcgagaagatttttctactggagtgttcagaaggttgggaggcaa
gactataagtttctatgatattttccccaggattccattttttaatatcttttttaatag
GTCCAAATTAACTGTGCTACAGATGACACACAACAAGCTTCTTCAAGAACATAATAATGC
ATTGAAAACAATTGAGGAACTAACAAGAAAAGAG
gtattcactgaaaaaaattacttccatagcctagtaatgaacagaaactgttgaacgttt
tgtatataaaatagttacatgaatccttcactaaatctggtttcaaaggttgttttccaa
tgtatcattatttcttgcatctagggtttgtaacttctgatgttccacatatgtgtaatg

 1.13 Intr +  28777  28935  159  0  0   48   94   271 0.999  22.96
caggcttgtctcccactcctgggctcaaacgatcctcccacctcagcctctcaattctag
gcatgagccaccacacccggccagagctgataattaaaaaaataaacctttttctaatat
tttactaaaacaggcagaattatttcaaaaccatttctagaataaatgtttctttttcag
TCAGAAAAAGTGGACAGGGCAGTGCTGAAGGAACTGAGTGAAAAACTGGAACTGGCAGAG
AAGGCTCTGGCTTCCAAACAGCTGCAAATGGATGAAATGAAGCAAACCATTGCCAAGCAG
GAAGAGGACCTGGAAACCATGACCATCCTCAGGGCTCAG
gtgaggcaccttccaaaaccccagctgagcgaggccagccctgactgtattctcgcattg
gaaagcaatggtgtttagaatgtttgtaattttctattttatatattttttcacccgtga
gtgtattaaaactttaaaattgaaacatttggaaagtgctcagtggatcttatctgttct

 1.14 Intr +  32210  32356  147  1  0   77   47    65 0.507   0.81
caacctctatttcctgggctcaggtgatcctcgtgcctcagcctcccaagtagctggaac
tacaagtgcatgccatcatgcccagctgattttttgtatttttagtagcgatgaggtttt
gccatgttgcccaggctgtcagcaggaggcctcagttcctcaccatgtggtctcctccag
AGGGATGCTTGGGTGCCCTCATGTCATGGCAGCTGGCTTCCCCCAAAGCAAGTGATCCAA
CAGAGAGCAAGGAGTGACAGCGTCTTTTGTGACCTAGTCTCAGAAGCCGTACACCATCAC
TTCTGCGGCATCCTGGAGGTTACACAG
gttgggtttattcattgtgggagggaaacatacaaggtgatgaataccaagaggcaagga
tcactggagccatcttaggaggctggtgaccacacatgggacatggattgaatatggaaa
agttcatgggaaatggtcttctgtctggttcaaatgctgatttggccacttaacaaattt

 1.15 Intr +  33099  33229  131  2  2  105  110   133 0.999  15.77
tatctgctatcggaatgtacctggaaagtcatggtcattatactgttttctagcaggatt
gtgcatctgtgattcacaagggctattgaaggatacagcactacctcctcatcgcataaa
cactgtaagaatctgcattcatctaggtactaacttctgtatctttttttcctctaacag
ATGGAAGTTTACTGTTCTGATTTTCATGCTGAAAGAGCAGCGAGAGAGAAAATTCATGAG
GAAAAGGAGCAACTGGCATTGCAGCTGGCAGTTCTGCTGAAAGAGAATGATGCTTTCGAA
GACGGAGGCAG
gtaaggaaaagagagaggaggacccagagctcacatcagcatggccgtagaagaggtgcc
tgtccaaagacgttcctgatttgaactataagaatagctgtgttcgcgccactgcactcc
tgcctaggtgacagagcgagtcccctgtctgaaaaataaataataataataataattgct

 1.16 Intr +  34534  34613   80  1  2   85  105    56 0.743   5.28
tttactttcactagtctcctagtgccaatagtatttaaaactaaaattagtctggttttt
atgaaccttggcagtgtagtttgagtcttttttcccctacttctgtggactgtctgctca
gtgttgtcatgtttcggggttgtagaacatcacacagcgtgttgcttttcgtcctggcag
GCAGTCCTTGATGGAGATGCAGAGTCGTCATGGGGCGAGAACAAGTGACTCTGACCAGCA
GGCTTACCTTGTTCAAAGAG
gtgagtcccgtgtgatcctggattttcaggaaatagctatcctatgaaaaagatgcttga
agaaaaattccacttcattctctacaatggattccaaatcaaggcaccaaaaatatagca
cccgtcagtctcattaccacagcactcccatctccatccattacccaccgaatccagacc

 1.17 Term +  37777  37898  122  2  2   38   42   108 0.103  -1.14
agatttttctctatgtgcatcgtgatgacttcagttaaagaccaaacacctgtgctcatg
tcccactacgtgttgaatacgaagttgaactgatgttaaaactcgccatctgttcttcaa
gtgaaacaaacacaactgcctgcaaaatggaactaatggaattatcatacttattcccag
GAGCTGAGGACAGGGACTGGCGGCAACAGCGGAATATTCCGATTCATTCCTGCCCCAAGT
GTGGAGAGGTTCTGCCTGACATAGACACGTTACAGATTCACGTGATGGATTGCATCATTT
AA
gtgttgatgtatcacctccccaaaactgttggtaaatgtcagattttttcctccaagagt
tgtgcttttgtgttatttgttttcactcaaatattttgcctcattattcttgttttaaaa
gaaagaaaacaggccgggcacagtggctcatgcctgtaatcccagcactttgggaggtcg

Predicted peptide sequence(s):


>OPTN_1|GENSCAN_predicted_peptide_1|734_aa
XSLVSVPSRSGVLSRRHDAEETVTLSEAKPGGRLGRIPQPVPRHKEVVTDTPVGDMGPLP
ELNEVPRVAIWLEHDAIRDVQQKVAFEIFKERRRDSMGVTRGPTAGPGGESARKSCLTEK
EDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFEEL
SAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPTDDSRLP
RAEAEQEKDQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSV
KEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEV
ALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKGPETVGSEVEALNLQVTSLFKE
LQEAHTKLSKAELMKKRLQEKCQALERKNSAIPSELNEKQELVYTNKKLELQVESMLSEI
KMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDRAVLKELSEKLEL
AEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQRDAWVPSCHGSWLPPKQVIQQRARS
DSVFCDLVSEAVHHHFCGILEVTQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKEN
DAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLP
DIDTLQIHVMDCII