GENSCAN 1.0	Date run: 14-Jan-104	Time: 20:55:35

Sequence MSMB_1 : 15442 bp : 45.28% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   7379   7484  106  1  1   99   83    44 0.881   4.79
tcaactagatacttttccttgttctacaatttcagcctagattaactggtttgttcagtt
atgagctccacatcataacctctcagcagagcccagccgagatcctggtacacagcactc
agtcaaggattatcctttgaattaattcattctccaccctgacctttcttcacattacag
AATGTTCTCCTGGGCAGCGTTGTGATCTTTGCCACCTTCGTGACTTTATGCAATGCATCA
TGCTATTTCATACCTAATGAGGGAGTTCCAGGAGATTCAACCAGGA
gtaagtcttggcttttcaatgtttattatgttattgcagcctggtagatggacctgtctg
cagatgaaagcctttgtgtttctgtttgtttgtttctttgttttttgagatagtcatgct
ctgtctcccaggctggagtgcagtggcaccatttcagctcactgcaaactcctcctcccg

 1.02 Intr +   8399   8504  106  0  1   90   95     7 0.896   0.87
tgaacagtactggaattagccgtgggtgaatacaggagcaccattcttagatacctttaa
aataattgagctcctctctctctgggaggggtgtagatagtaggggcaggactcaatgtc
ctgataggccttgttctcattgcatgacttgcactgatgatgttgtgtgtattattttag
AATGCATGGATCTCAAAGGAAACAAACACCCAATAAACTCGGAGTGGCAGACTGACAACT
GTGAGACATGCACTTGCTACGAAACAGAAATTTCATGTTGCACCCT
gtaagtctcaagccagtgctggccaagagggggacatagctgttctctgaggaacagcta
ctccgtcttgcaaaattccaatcttcaggggtttagtttttgttttagttttttatagac
tttatatagagtagttttagattcacagcaaaactgagcagaggtacagaaatttcccat

 1.03 Term +  13895  14048  154  2  1   87   35   180 0.811   9.99
cctgcaggatggaatgtaggggtgagctgtgtgactctatggtacagactggtccaggtt
cctggaggtcacactctggggctgccagccaaagggtgcccttaagttggagtgtgggtg
acttcctgaacagagctggcactggggagggggtgctcggggtcctttctcttctaacag
GCCCCAGTTTTGTCTCAATGACAGTGTTTCTACACCTGTGGGTTATGACAAAGACAACTG
CCAAAGAATCTTCAAGAAGGAGGACTGCAAGTATATCGTGGTGGAGAAGAAGGACCCAAA
AAAGACCTGTTCTGTCAGTGAATGGATAATCTAA
tgtgcttctagtaggcacagggctcccaggccaggcctcattctcctctggcctctaata
gtcaatgattgtgtagccatgcctatcagtaaaaagatttttgagcaaacacttgaatat
gtgtgtccttttaatttataatttatgtatgcattgatttaatacacattataaagaata

Predicted peptide sequence(s):


>MSMB_1|GENSCAN_predicted_peptide_1|121_aa
NVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCT
CYETEISCCTLPQFCLNDSVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWI
I