GENSCAN 1.0	Date run: 14-Jan-104	Time: 22:28:28

Sequence MRPL43_1 : 12093 bp : 53.58% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1273   1403  131  0  2   72   99   216 0.420  20.18
cccaggttaccacttttctctctcccacttcgccggcaacgtgagtctcccgcacatgct
actcgccttgacctcggaagcaaaactccgggagcggtcgtcccggaaccggaagcctcg
aggtttagtcccgcccccctctcctcgctgcttaggctccgcggcctccaagctgtagct
ATGACGGCGCGCGGGACTCCGAGCCGCTTCTTGGCCAGCGTTCTCCACAACGGACTGGGT
CGCTATGTGCAGCAGCTGCAGCGTCTGAGCTTCAGCGTCAGCCGCGACGGCGCCTCGTCT
CGCGGCGCCAG
gtgagccaagggaagtgcgcaggcgcgggtcggggtgggtgtggaggtggcaacgactcc
ccgggtaggtcgcccccagtcaggggtcatactgctcactgtcccgggtcgcttagggag
ttcgtggagcgggaggtgatcgacttcgcccgacggaatccaggggtcgtaatatatgta

 1.02 Term +   1520   1982  463  2  1   38   49   586 0.922  44.61
tgcagcagctgcagcgtctgagcttcagcgtcagccgcgacggcgcctcgtctcgcggcg
ccaggtgagccaagggaagtgcgcaggcgcgggtcggggtgggtgtggaggtggcaacga
ctccccgggtaggtcgcccccagtcaggggtcatactgctcactgtcccgggtcgcttag
GGAGTTCGTGGAGCGGGAGGTGATCGACTTCGCCCGACGGAATCCAGGGGTCGTAATATA
TGTAAACTCGCGTCCGTGCTGCGTGCCCAGAGTAGTGGCCGAATACCGTGAGTGGGGCCG
GGCTCGGGCTGGAGGGCGGGATCAGGGGCTCGACCCGCTATCCTCCTTCTCGCTTGGTCG
CACCGGCCAGCTTCCACCCACTCTCACCCCTCTTCTGCCAGTTAACGGGGCTGTGCGCGA
GGAGAGCATCCACTGCAAGTCGGTCGAGGAGATCTCGACGCTGGTGCAGAAGCTGGCCGA
CCAGTCGGGCTTGGACGTGATCCGCATCCGCAAGCCCTTCCACACCGACAACCCTAGCAT
CCAGGGCCAGTGGCACCCCTTCACCAACAAGCCGACCACGTTCCGCGGGCTACGCCCCCG
AGAGGTTCAGGATCCTGCCCCAGCCCAGGTGCAAGCACAGTGA
agagttgccccaccaactgcagccccaggctttggactgttactccggtaaaggtggttc
ttcccctttgggattccaagcccaggcaaatggaacccatcaatgggcaagttgacagag
gttctgcttgggataatgaagagctgcctgtttctttccagtgcctgcttctgggggcag

 2.11 PlyA -   3122   3117    6                               1.05
 2.10 Term -   5411   4585  827  0  2  101   52   806 0.992  72.00
 2.09 Intr -   7548   7487   62  2  2   94  111    27 0.996   4.47
 2.08 Intr -   7894   7719  176  1  2   56   75   110 0.825   5.75
 2.07 Intr -   8138   8023  116  0  2   86   68    42 0.994   2.67
 2.06 Intr -   8594   8372  223  2  1   60   49   136 0.988   5.13
 2.05 Intr -   8868   8724  145  2  1  118  109   172 0.993  23.09
 2.04 Intr -   9614   9445  170  2  2  120   49   133 0.999  11.86
 2.03 Intr -   9867   9671  197  1  2   66   47   287 0.760  22.05
 2.02 Intr -  10421  10328   94  2  1  107   85   124 0.996  14.04
 2.01 Intr -  11084  10986   99  2  0   83   68    30 0.705   1.31

Predicted peptide sequence(s):


>MRPL43_1|GENSCAN_predicted_peptide_1|197_aa
MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPG
VVIYVNSRPCCVPRVVAEYREWGRARAGGRDQGLDPLSSFSLGRTGQLPPTLTPLLPVNG
AVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKPTTFRG
LRPREVQDPAPAQVQAQ

>MRPL43_1|GENSCAN_predicted_peptide_2|702_aa
TECFNHVRFLQRLNSTHLYACGTHAFQPLCAAIDAEAFTLPTSFEEGKEKCPYDPARGFT
GLIIDAEFVFSVLVRESKASAVGDDDKVYYFFTERATEEGSGSFTQSRSSHRVARVARVC
KVDWADVGARGDLGGKKILQKKWTSFLKARLICHIPLYETLRGVCSLDAETSSRTHFYAA
FTLSTQWKTLEASAICRYDLAEIQAVFAGPYMEYQDGSRRWGRYEGGVPEPRPGSCITDS
LRSQGYNSSQDLPSLVLDFVKLHPLMARPVVPTRGRPLLLKRNIRYTHLTGTPVTTPAGP
TYDLLFLGTADGWIHKAVVLGSGMHIIEETQVFRESQSVENLVISLLQHSLYVGAPSGVI
QLPLSSCSRYRSCYDCILARDPYCGWDPGTHACAAATTIANRSQGSRTALIQDIERGNRG
CESSRDTGPPPPLKTRSVLRGDDVLLPCDQPSNLARALWLLNGSMGLSDGQGGYRVGVDG
LLVTDAQPEHSGNYGCYAEENGLRTLLASYSLTVRPATPAPAPKAPATPGAQLAPDVRLL
YVLAIAALGGLCLILASSLLYVACLREGRRGRRRKYSLGRASRAGGSAVQLQTVSGQCPG
EEDEGDDEGAGGLEGSCLQIIPGEGAPAPPPPPPPPPPAELTNGLVALPSRLRRMNGNSY
VLLRQSNNGVPAGPCSFAEELSRILEKRKHTQLVEQLDESSV