GENSCAN 1.0	Date run: 14-Jan-104	Time: 21:46:00

Sequence MKI67_1 : 31941 bp : 44.07% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1649   1829  181  2  1   53  105    98 0.736   7.87
aggcgctggcgacaacaccccagctgccggactttggggcgccgggggctgcggtcggat
cgtcctggggtccccgctagctagctgcggtgtgcgcttctgtggccggggataggtgaa
ttgggcacggggcccttcttagctcctttgctatcagagtaactcgcacctcttttgcag
TGGAAGAGTTGTAAATTTGCTTCTGGCCTTCCCCTACGGATTATACCTGGCCTTCCCCTA
CGGATTATACTCAACTTACTGTTTAGAAAATGTGGCCCACGAGACGCCTGGTTACTATCA
AAAGGAGCGGGGTCGACGGTCCCCACTTTCCCCTGAGCCTCAGCACCTGCTTGTTTGGAA
G
gtgagccccgcgggcgcgcgcggacgttttagctgagaaagaggaaaataccttagtcac
agaataaagtccagaaacgcgctctaggattgggtcctgccgtcacttttccttggtgct
tctcccattcgttactaagttgacatagttgtgtttttttgttttgtaagtataaatttg

 1.02 Intr +   4409   4524  116  1  2  104   96    63 0.919   7.95
catgaaggggtattgaatgtgacatccgtatccagcttcctgttgtgtcaaaacaacatt
gcaaaattgaaatccatgagcaggaggtgagtgggttttttgaagatctacttttaaagc
tttttagttcacttttaatctgttcattagttacatatttccccttcttttcacttgcag
GCAATATTACATAATTTCAGTTCCACAAATCCAACACAAGTAAATGGGTCTGTTATTGAT
GAGCCTGTACGGCTAAAACATGGAGATGTAATAACTATTATTGATCGTTCCTTCAG
gtaggtaaaagctgattggtctaacagtaaatgtcatcttctgattaaccataaactagt
gtcaaagtcaactgtcattcttctttaatgttcatggatgtcaaagtatttcaggttttc
attctcaacactaatcttaatttaaaaggatatggatctaggaagatgactaattgggac

 1.03 Intr +   8086   8152   67  1  1   67   59    21 0.268  -3.99
aatcctagtttttagtgtaaaagcacttttctaactctaaatttatttctttgtataagg
tgatgtcttgaactaaacccaaagtttgttcgttgatccttggacattaagtggatatgg
agacttccgccccagggtataaatttttaatcaggatctttgtcgttctataaactgcag
GTATGAAAATGAAAGTCTTCAGAATGGAAGGAAGTCAACTGAATTTCCAAGAAAAATACG
TGAACAG
gtgatagaaaatatccaagtttgggctgattcgtttcgatgatatgaaatcatttatgta
tgctttaatgatttcttacttgaaatcagttacaaagagggtggttactgttatagtagg
aaaatgtaactaaagtataaaaacgagttgaacttagacgtattaaaataatctaaaatg

 1.04 Intr +  10869  10914   46  2  1   78  105    -3 0.527  -1.62
caggctgttctcaaactcctgacctcaagtgatccgcccaccttggcctcccaaagtgct
gggattacaggcatgagccatcatgcccagccagaaaacaataaataatattttcactgt
tgtgactgtcatcatttagaaagacctgcaaataactgttcttattttcccaacttacag
GAGCCAGCACGTCGTGTCTCAAGATCTAGCTTCTCTTCTGACCCTG
gtgagtagtggttgggttttgttccagaatcctgaaagatcaggtctttgcgaagcatat
tggcaaagaaggggcaacaagaatgcaagtgctaaatgtctagcctgtcagaaatggagg
aggtgtcatttaacatgtcaacgacagacagatgcctaactttcccttggtgactgatgg

 1.05 Intr +  11398  12477 1080  2  0   12   83   562 0.975  38.21
tatttgtatcataatactagtatcataagacttgcaagttttaggcattaaataatttgt
aggccaagtaaaagctagcttataagacaacctgaaacaattaaaatattgaattccaca
aatgttaatcattgagaaaatgctgaacttctgtttcttatttcataattcattgccaag
ATGAGAAAGCTCAAGATTCCAAGGCCTATTCAAAAATCACTGAAGGAAAAGTTTCAGGAA
ATCCTCAGGTACATATCAAGAATGTCAAAGAAGACAGTACCGCAGATGACTCAAAAGACA
GTGTTGCTCAGGGAACAACTAATGTTCATTCCTCAGAACATGCTGGACGTAATGGCAGAA
ATGCAGCTGATCCCATTTCTGGGGATTTTAAAGAAATTTCCAGCGTTAAATTAGTGAGCC
GTTATGGAGAATTGAAGTCTGTTCCCACTACACAATGTCTTGACAATAGCAAAAAAAATG
AATCTCCCTTTTGGAAGCTTTATGAGTCAGTGAAGAAAGAGTTGGATGTAAAATCACAAA
AAGAAAATGTCCTACAGTATTGTAGAAAATCTGGATTACAAACTGATTACGCAACAGAGA
AAGAAAGTGCTGATGGTTTACAGGGGGAGACCCAACTGTTGGTCTCGCGTAAGTCAAGAC
CAAAATCTGGTGGGAGCGGCCACGCTGTGGCAGAGCCTGCTTCACCTGAACAAGAGCTTG
ACCAGAACAAGGGGAAGGGAAGAGACGTGGAGTCTGTTCAGACTCCCAGCAAGGCTGTGG
GCGCCAGCTTTCCTCTCTATGAGCCGGCTAAAATGAAGACCCCTGTACAATATTCACAGC
AACAAAATTCTCCACAAAAACATAAGAACAAAGACCTGTATACTACTGGTAGAAGAGAAT
CTGTGAATCTGGGTAAAAGTGAAGGCTTCAAGGCTGGTGATAAAACTCTTACTCCCAGGA
AGCTTTCAACTAGAAATCGAACACCAGCTAAAGTTGAAGATGCAGCTGACTCTGCCACTA
AGCCAGAAAATCTCTCTTCCAAAACCAGAGGAAGTATTCCTACAGATGTGGAAGTTCTGC
CTACGGAAACTGAAATTCACAATGAGCCATTTTTAACTCTGTGGCTCACTCAAGTTGAGA
GGAAGATCCAAAAGGATTCCCTCAGCAAGCCTGAGAAATTGGGCACTACAGCTGGACAGA
TGTGCTCTGGGTTACCTGGTCTTAGTTCAGTTGATATCAACAACTTTGGTGATTCCATTA

gtaagtttatttaattgtaaatttatttttctaaaagatgaacaccttctatgtagctgt
gagaccttcattctttcagtagtgattagctttgtggaagagaatgtaagcacataaggc
acagggataagacagacacgcacgctgttttcgctaatagatgaatactgaaggcctagg

 1.06 Intr +  13803  13978  176  1  2   71  113    49 0.992   5.36
caatcctttaggaactcttagtagcttagcttcaccaggattgcaagaatagaggcgtgc
tgtaggtactgtgtttcgatgacttttcacttggtttgtctttaatgctaacgtgaaata
aatcactagtcttggtatgttttttcattgctctttccacatttgtatccgttactttag
ATGAGAGTGAGGGAATACCTTTGAAAAGAAGGCGTGTGTCCTTTGGTGGGCACCTAAGAC
CTGAACTATTTGATGAAAACTTGCCTCCTAATACGCCTCTCAAAAGGGGAGAAGCCCCAA
CCAAAAGAAAGTCTCTGGTAATGCACACTCCACCTGTCCTGAAGAAAATCATCAAG
gtgagttgaacaagcagcatcccattcacgcccagtggctcacacaccgggtacctattc
ctttccaaatactgacacaagtagaattatgatgaagacctttatttatttattaaagaa
acaagtttttaaaaagacgaatgaaagctcattgatgtgggcaccagcaaaggagcccct

 1.07 Intr +  15589  15760  172  0  1  108   98    69 0.988   9.42
aactaaagtcataaaacatggtcctcaaaggtcaatgaacaaaaggcaaagaagacctgc
tactccaaaggtaggggcctcactgaatggctgctttacacataccggtgtcatcgaagc
ttgcattcagtgtggatttatgctttaatgtcctgtttacctccttcctgttttctacag
AAGCCTGTGGGCGAAGTTCACAGTCAATTTAGTACAGGCCACGCAAACTCTCCTTGTACC
ATAATAATAGGGAAAGCTCATACTGAAAAAGTACATGTGCCTGCTCGACCCTACAGAGTG
CTCAACAACTTCATTTCCAACCAAAAAATGGACTTTAAGGAAGATCTTTCAG
gtaaaaacgtagtcttagatcttataaatcttttgactctactgttttttactgtgttaa
tgtttgttttgctaactttgtttatctgctgtgaaagagattataaaataaacgactcaa
tcacccttctggggtcttagtgttcagggaagataaagctgttttggcttgcaaagacaa

 1.08 Intr +  17982  24826 6845  1  2   76  100  6141 0.976 601.62
cattattcttaattgtgcatggctcttataagacagatttatagacacataagtagcctc
atgtcgttcagtgaatacgaagctaaatatttagttttttaccatattttatgaggctgt
aatactcgattgacatgagacactaatagaatgtttttattgtgtatgtttttatttcag
GAGGAAATGTGTTCTTCAGTGCACAGAATGCAGCAAAACAGCCATCTGATAAATGCTCTG
CAAGCCCTCCCTTAAGACGGCAGTGTATTAGAGAAAATGGAAACGTAGCAAAAACGCCCA
GGAACACCTACAAAATGACTTCTCTGGAGACAAAAACTTCAGATACTGAGACAGAGCCTT
CAAAAACAGTATCCACTGCAAACAGGTCAGGAAGGTCTACAGAGTTCAGGAATATACAGA
AGCTACCTGTGGAAAGTAAGAGTGAAGAAACAAATACAGAAATTGTTGAGTGCATCCTAA
AAAGAGGTCAGAAGGCAACACTACTACAACAAAGGAGAGAAGGAGAGATGAAGGAAATAG
AAAGACCTTTTGAGACATATAAGGAAAATATTGAATTAAAAGAAAACGATGAAAAGATGA
AAGCAATGAAGAGATCAAGAACTTGGGGGCAGAAATGTGCACCAATGTCTGACCTGACAG
ACCTCAAGAGCTTGCCTGATACAGAACTCATGAAAGACACGGCACGTGGCCAGAATCTCC
TCCAAACCCAAGATCATGCCAAGGCACCAAAGAGTGAGAAAGGCAAAATCACTAAAATGC
CCTGCCAGTCATTACAACCAGAACCAATAAACACCCCAACACACACAAAACAACAGTTGA
AGGCATCCCTGGGGAAAGTAGGTGTGAAAGAAGAGCTCCTAGCAGTCGGCAAGTTCACAC
GGACGTCAGGGGAGACCACGCACACGCACAGAGAGCCAGCAGGAGATGGCAAGAGCATCA
GAACGTTTAAGGAGTCTCCAAAGCAGATCCTGGACCCAGCAGCCCGTGTAACTGGAATGA
AGAAGTGGCCAAGAACGCCTAAGGAAGAGGCCCAGTCACTAGAAGACCTGGCTGGCTTCA
AAGAGCTCTTCCAGACACCAGGTCCCTCTGAGGAATCAATGACTGATGAGAAAACTACCA
AAATAGCCTGCAAATCTCCACCACCAGAATCAGTGGACACTCCAACAAGCACAAAGCAAT
GGCCTAAGAGAAGTCTCAGGAAAGCAGATGTAGAGGAAGAATTCTTAGCACTCAGGAAAC
TAACACCATCAGCAGGGAAAGCCATGCTTACGCCCAAACCAGCAGGAGGTGATGAGAAAG
ACATTAAAGCATTTATGGGAACTCCAGTGCAGAAACTGGACCTGGCAGGAACTTTACCTG
GCAGCAAAAGACAGCTACAGACTCCTAAGGAAAAGGCCCAGGCTCTAGAAGACCTGGCTG
GCTTTAAAGAGCTCTTCCAGACTCCTGGTCACACCGAGGAATTAGTGGCTGCTGGTAAAA
CCACTAAAATACCCTGCGACTCTCCACAGTCAGACCCAGTGGACACCCCAACAAGCACAA
AGCAACGACCCAAGAGAAGTATCAGGAAAGCAGATGTAGAGGGAGAACTCTTAGCGTGCA
GGAATCTAATGCCATCAGCAGGCAAAGCCATGCACACGCCTAAACCATCAGTAGGTGAAG
AGAAAGACATCATCATATTTGTGGGAACTCCAGTGCAGAAACTGGACCTGACAGAGAACT
TAACCGGCAGCAAGAGACGGCCACAAACTCCTAAGGAAGAGGCCCAGGCTCTGGAAGACC
TGACTGGCTTTAAAGAGCTCTTCCAGACCCCTGGTCATACTGAAGAAGCAGTGGCTGCTG
GCAAAACTACTAAAATGCCCTGCGAATCTTCTCCACCAGAATCAGCAGACACCCCAACAA
GCACAAGAAGGCAGCCCAAGACACCTTTGGAGAAAAGGGACGTACAGAAGGAGCTCTCAG
CCCTGAAGAAGCTCACACAGACATCAGGGGAAACCACACACACAGATAAAGTACCAGGAG
GTGAGGATAAAAGCATCAACGCGTTTAGGGAAACTGCAAAACAGAAACTGGACCCAGCAG
CAAGTGTAACTGGTAGCAAGAGGCACCCAAAAACTAAGGAAAAGGCCCAACCCCTAGAAG
ACCTGGCTGGCTTGAAAGAGCTCTTCCAGACACCAGTATGCACTGACAAGCCCACGACTC
ACGAGAAAACTACCAAAATAGCCTGCAGATCACAACCAGACCCAGTGGACACACCAACAA
GCTCCAAGCCACAGTCCAAGAGAAGTCTCAGGAAAGTGGACGTAGAAGAAGAATTCTTCG
CACTCAGGAAACGAACACCATCAGCAGGCAAAGCCATGCACACACCCAAACCAGCAGTAA
GTGGTGAGAAAAACATCTACGCATTTATGGGAACTCCAGTGCAGAAACTGGACCTGACAG
AGAACTTAACTGGCAGCAAGAGACGGCTACAAACTCCTAAGGAAAAGGCCCAGGCTCTAG
AAGACCTGGCTGGCTTTAAAGAGCTCTTCCAGACACGAGGTCACACTGAGGAATCAATGA
CTAACGATAAAACTGCCAAAGTAGCCTGCAAATCTTCACAACCAGACCCAGACAAAAACC
CAGCAAGCTCCAAGCGACGGCTCAAGACATCCCTGGGGAAAGTGGGCGTGAAAGAAGAGC
TCCTAGCAGTTGGCAAGCTCACACAGACATCAGGAGAGACTACACACACACACACAGAGC
CAACAGGAGATGGTAAGAGCATGAAAGCATTTATGGAGTCTCCAAAGCAGATCTTAGACT
CAGCAGCAAGTCTAACTGGCAGCAAGAGGCAGCTGAGAACTCCTAAGGGAAAGTCTGAAG
TCCCTGAAGACCTGGCCGGCTTCATCGAGCTCTTCCAGACACCAAGTCACACTAAGGAAT
CAATGACTAACGAAAAAACTACCAAAGTATCCTACAGAGCTTCACAGCCAGACCTAGTGG
ACACCCCAACAAGCTCCAAGCCACAGCCCAAGAGAAGTCTCAGGAAAGCAGACACTGAAG
AAGAATTTTTAGCATTTAGGAAACAAACGCCATCAGCAGGCAAAGCCATGCACACACCCA
AACCAGCAGTAGGTGAAGAGAAAGACATCAACACGTTTTTGGGAACTCCAGTGCAGAAAC
TGGACCAGCCAGGAAATTTACCTGGCAGCAATAGACGGCTACAAACTCGTAAGGAAAAGG
CCCAGGCTCTAGAAGAACTGACTGGCTTCAGAGAGCTTTTCCAGACACCATGCACTGATA
ACCCCACGACTGATGAGAAAACTACCAAAAAAATACTCTGCAAATCTCCGCAATCAGACC
CAGCGGACACCCCAACAAACACAAAGCAACGGCCCAAGAGAAGCCTCAAGAAAGCAGACG
TAGAGGAAGAATTTTTAGCATTCAGGAAACTAACACCATCAGCAGGCAAAGCCATGCACA
CGCCTAAAGCAGCAGTAGGTGAAGAGAAAGACATCAACACATTTGTGGGGACTCCAGTGG
AGAAACTGGACCTGCTAGGAAATTTACCTGGCAGCAAGAGACGGCCACAAACTCCTAAAG
AAAAGGCCAAGGCTCTAGAAGATCTGGCTGGCTTCAAAGAGCTCTTCCAGACACCAGGTC
ACACTGAGGAATCAATGACCGATGACAAAATCACAGAAGTATCCTGCAAATCTCCACAAC
CAGACCCAGTCAAAACCCCAACAAGCTCCAAGCAACGACTCAAGATATCCTTGGGGAAAG
TAGGTGTGAAAGAAGAGGTCCTACCAGTCGGCAAGCTCACACAGACGTCAGGGAAGACCA
CACAGACACACAGAGAGACAGCAGGAGATGGAAAGAGCATCAAAGCGTTTAAGGAATCTG
CAAAGCAGATGCTGGACCCAGCAAACTATGGAACTGGGATGGAGAGGTGGCCAAGAACAC
CTAAGGAAGAGGCCCAATCACTAGAAGACCTGGCCGGCTTCAAAGAGCTCTTCCAGACAC
CAGACCACACTGAGGAATCAACAACTGATGACAAAACTACCAAAATAGCCTGCAAATCTC
CACCACCAGAATCAATGGACACTCCAACAAGCACAAGGAGGCGGCCCAAAACACCTTTGG
GGAAAAGGGATATAGTGGAAGAGCTCTCAGCCCTGAAGCAGCTCACACAGACCACACACA
CAGACAAAGTACCAGGAGATGAGGATAAAGGCATCAACGTGTTCAGGGAAACTGCAAAAC
AGAAACTGGACCCAGCAGCAAGTGTAACTGGTAGCAAGAGGCAGCCAAGAACTCCTAAGG
GAAAAGCCCAACCCCTAGAAGACTTGGCTGGCTTGAAAGAGCTCTTCCAGACACCAATAT
GCACTGACAAGCCCACGACTCATGAGAAAACTACCAAAATAGCCTGCAGATCTCCACAAC
CAGACCCAGTGGGTACCCCAACAATCTTCAAGCCACAGTCCAAGAGAAGTCTCAGGAAAG
CAGACGTAGAGGAAGAATCCTTAGCACTCAGGAAACGAACACCATCAGTAGGGAAAGCTA
TGGACACACCCAAACCAGCAGGAGGTGATGAGAAAGACATGAAAGCATTTATGGGAACTC
CAGTGCAGAAATTGGACCTGCCAGGAAATTTACCTGGCAGCAAAAGATGGCCACAAACTC
CTAAGGAAAAGGCCCAGGCTCTAGAAGACCTGGCTGGCTTCAAAGAGCTCTTCCAGACAC
CAGGCACTGACAAGCCCACGACTGATGAGAAAACTACCAAAATAGCCTGCAAATCTCCAC
AACCAGACCCAGTGGACACCCCAGCAAGCACAAAGCAACGGCCCAAGAGAAACCTCAGGA
AAGCAGACGTAGAGGAAGAATTTTTAGCACTCAGGAAACGAACACCATCAGCAGGCAAAG
CCATGGACACACCAAAACCAGCAGTAAGTGATGAGAAAAATATCAACACATTTGTGGAAA
CTCCAGTGCAGAAACTGGACCTGCTAGGAAATTTACCTGGCAGCAAGAGACAGCCACAGA
CTCCTAAGGAAAAGGCTGAGGCTCTAGAGGACCTGGTTGGCTTCAAAGAACTCTTCCAGA
CACCAGGTCACACTGAGGAATCAATGACTGATGACAAAATCACAGAAGTATCCTGTAAAT
CTCCACAGCCAGAGTCATTCAAAACCTCAAGAAGCTCCAAGCAAAGGCTCAAGATACCCC
TGGTGAAAGTGGACATGAAAGAAGAGCCCCTAGCAGTCAGCAAGCTCACACGGACATCAG
GGGAGACTACGCAAACACACACAGAGCCAACAGGAGATAGTAAGAGCATCAAAGCGTTTA
AGGAGTCTCCAAAGCAGATCCTGGACCCAGCAGCAAGTGTAACTGGTAGCAGGAGGCAGC
TGAGAACTCGTAAGGAAAAGGCCCGTGCTCTAGAAGACCTGGTTGACTTCAAAGAGCTCT
TCTCAGCACCAGGTCACACTGAAGAGTCAATGACTATTGACAAAAACACAAAAATTCCCT
GCAAATCTCCCCCACCAGAACTAACAGACACTGCCACGAGCACAAAGAGATGCCCCAAGA
CACGTCCCAGGAAAGAAGTAAAAGAGGAGCTCTCAGCAGTTGAGAGGCTCACGCAAACAT
CAGGGCAAAGCACACACACACACAAAGAACCAGCAAGCGGTGATGAGGGCATCAAAGTAT
TGAAGCAACGTGCAAAGAAGAAACCAAACCCAGTAGAAGAGGAACCCAGCAGGAGAAGGC
CAAGAGCACCTAAGGAAAAGGCCCAACCCCTGGAAGACCTGGCCGGCTTCACAGAGCTCT
CTGAAACATCAGGTCACACTCAGGAATCACTGACTGCTGGCAAAGCCACTAAAATACCCT
GCGAATCTCCCCCACTAGAAGTGGTAGACACCACAGCAAGCACAAAGAGGCATCTCAGGA
CACGTGTGCAGAAGGTACAAGTAAAAGAAGAGCCTTCAGCAGTCAAGTTCACACAAACAT
CAGGGGAAACCACGGATGCAGACAAAGAACCAGCAGGTGAAGATAAAGGCATCAAAGCAT
TGAAGGAATCTGCAAAACAGACACCGGCTCCAGCAGCAAGTGTAACTGGCAGCAGGAGAC
GGCCAAGAGCACCCAGGGAAAGTGCCCAAGCCATAGAAGACCTAGCTGGCTTCAAAGACC
CAGCAGCAGGTCACACTGAAGAATCAATGACTGATGACAAAACCACTAAAATACCCTGCA
AATCATCACCAGAACTAGAAGACACCGCAACAAGCTCAAAGAGACGGCCCAGGACACGTG
CCCAGAAAGTAGAAGTGAAGGAGGAGCTGTTAGCAGTTGGCAAGCTCACACAAACCTCAG
GGGAGACCACGCACACCGACAAAGAGCCGGTAGGTGAGGGCAAAGGCACGAAAGCATTTA
AGCAACCTGCAAAGCGGAAGCTGGACGCAGAAGATGTAATTGGCAGCAGGAGACAGCCAA
GAGCACCTAAGGAAAAGGCCCAACCCCTGGAAGATCTGGCCAGCTTCCAAGAGCTCTCTC
AAACACCAGGCCACACTGAGGAACTGGCAAATGGTGCTGCTGATAGCTTTACAAGCGCTC
CAAAGCAAACACCTGACAGTGGAAAACCTCTAAAAATATCCAGAAGAGTTCTTCGGGCCC
CTAAAGTAGAACCCGTGGGAGACGTGGTAAGCACCAGAGACCCTGTAAAATCACAAAGCA
AAAGCAACACTTCCCTGCCCCCACTGCCCTTCAAGAGGGGAGGTGGCAAAGATGGAAGCG
TCACGGGAACCAAGAGGCTGCGCTGCATGCCAGCACCAGAGGAAATTGTGGAGGAGCTGC
CAGCCAGCAAGAAGCAGAGGGTTGCTCCCAGGGCAAGAGGCAAATCATCCGAACCCGTGG
TCATCATGAAGAGAAGTTTGAGGACTTCTGCAAAAAGAATTGAACCTGCGGAAGAGCTGA
ACAGCAACGACATGAAAACCAACAAAGAGGAACACAAATTACAAGACTCGGTCCCTGAAA
ATAAG
gtgagaggaagtattacagcatcactcaatatcgtcttggatagttgtgaatttctgtgt
tatactttgcatgtaacctgacgttataagtggttatcctttccccagagggtttccttt
aacactgaataactgcaggccatggtaaagaatcttcttgggacctatagagggaataga

 1.09 Intr +  25704  26147  444  2  0   76  121   173 0.891  13.00
agcaaagtaccaaggcattaccttgactatcctagatgacaagtctcttagacaattcat
cagtgtgtgattttcaaatgatttctccttttaggttactgttgattgtgctccctgttg
aattttgaagtttgttttactaattattggaattttgtggatgtcttctcatttctttag
GGAATATCCCTGCGCTCCAGACGCCAAAATAAGACTGAGGCAGAACAGCAAATAACTGAG
GTCTTTGTATTAGCAGAAAGAATAGAAATAAACAGAAATGAAAAGAAGCCCATGAAGACC
TCCCCAGAGATGGACATTCAGAATCCAGATGATGGAGCCCGGAAACCCATACCTAGAGAC
AAAGTCACTGAGAACAAAAGGTGCTTGAGGTCTGCTAGACAGAATGAGAGCTCCCAGCCT
AAGGTGGCAGAGGAGAGCGGAGGGCAGAAGAGTGCGAAGGTTCTCATGCAGAATCAGAAA
GGGAAAGGAGAAGCAGGAAATTCAGACTCCATGTGCCTGAGATCAAGAAAGACAAAAAGC
CAGCCTGCAGCAAGCACTTTGGAGAGCAAATCTGTGCAGAGAGTAACGCGGAGTGTCAAG
AGGTGTGCAGAAAATCCAAAGAAG
gtaagccatttactgtttccctgttttaaaagacacagaatgttttgatgtattttttgc
ccaaggttgcaaaggcaaacaaaaagcattatcttcaacagcactctgccagctcccagt
tacattaatggaaggagcattatgctaagacataaatttggtcattttagttatattttg

 1.10 Term +  28575  28643   69  2  0   81   42    37 0.122  -3.66
ggctcctggactgagaatagttgaacaccgggggctttgtgaaggagtctgggccaaggt
ttgccctcagctttgcagaatgaagccttgaggtctgtcaccacccacagccaccctaca
gcagccttaactgtgacacttgccacactgtgtcgtcgtttgtttgcctatgtcctccag
GGCACGGTGGCAGGAACAACTATCCTCGTCTGTCCCAACACTGAGCAGGCACTCGGTAAA
CACGAATGA
atggatgagcgcacggatgaatggagcttacaagatctgtctttccaatggccgggggca
tttggtccccaaattaaggctattggacatctgcacaggacagtcctatttttgatgtcc
tttcctttctgaaaataaagttttgtgctttggagaatgactcgtgagcacatctttagg

Predicted peptide sequence(s):


>MKI67_1|GENSCAN_predicted_peptide_1|3065_aa
XGRVVNLLLAFPYGLYLAFPYGLYSTYCLENVAHETPGYYQKERGRRSPLSPEPQHLLVW
KAILHNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENESLQNGRKSTEFPRKIR
EQEPARRVSRSSFSSDPDEKAQDSKAYSKITEGKVSGNPQVHIKNVKEDSTADDSKDSVA
QGTTNVHSSEHAGRNGRNAADPISGDFKEISSVKLVSRYGELKSVPTTQCLDNSKKNESP
FWKLYESVKKELDVKSQKENVLQYCRKSGLQTDYATEKESADGLQGETQLLVSRKSRPKS
GGSGHAVAEPASPEQELDQNKGKGRDVESVQTPSKAVGASFPLYEPAKMKTPVQYSQQQN
SPQKHKNKDLYTTGRRESVNLGKSEGFKAGDKTLTPRKLSTRNRTPAKVEDAADSATKPE
NLSSKTRGSIPTDVEVLPTETEIHNEPFLTLWLTQVERKIQKDSLSKPEKLGTTAGQMCS
GLPGLSSVDINNFGDSINESEGIPLKRRRVSFGGHLRPELFDENLPPNTPLKRGEAPTKR
KSLVMHTPPVLKKIIKKPVGEVHSQFSTGHANSPCTIIIGKAHTEKVHVPARPYRVLNNF
ISNQKMDFKEDLSGGNVFFSAQNAAKQPSDKCSASPPLRRQCIRENGNVAKTPRNTYKMT
SLETKTSDTETEPSKTVSTANRSGRSTEFRNIQKLPVESKSEETNTEIVECILKRGQKAT
LLQQRREGEMKEIERPFETYKENIELKENDEKMKAMKRSRTWGQKCAPMSDLTDLKSLPD
TELMKDTARGQNLLQTQDHAKAPKSEKGKITKMPCQSLQPEPINTPTHTKQQLKASLGKV
GVKEELLAVGKFTRTSGETTHTHREPAGDGKSIRTFKESPKQILDPAARVTGMKKWPRTP
KEEAQSLEDLAGFKELFQTPGPSEESMTDEKTTKIACKSPPPESVDTPTSTKQWPKRSLR
KADVEEEFLALRKLTPSAGKAMLTPKPAGGDEKDIKAFMGTPVQKLDLAGTLPGSKRQLQ
TPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRS
IRKADVEGELLACRNLMPSAGKAMHTPKPSVGEEKDIIIFVGTPVQKLDLTENLTGSKRR
PQTPKEEAQALEDLTGFKELFQTPGHTEEAVAAGKTTKMPCESSPPESADTPTSTRRQPK
TPLEKRDVQKELSALKKLTQTSGETTHTDKVPGGEDKSINAFRETAKQKLDPAASVTGSK
RHPKTKEKAQPLEDLAGLKELFQTPVCTDKPTTHEKTTKIACRSQPDPVDTPTSSKPQSK
RSLRKVDVEEEFFALRKRTPSAGKAMHTPKPAVSGEKNIYAFMGTPVQKLDLTENLTGSK
RRLQTPKEKAQALEDLAGFKELFQTRGHTEESMTNDKTAKVACKSSQPDPDKNPASSKRR
LKTSLGKVGVKEELLAVGKLTQTSGETTHTHTEPTGDGKSMKAFMESPKQILDSAASLTG
SKRQLRTPKGKSEVPEDLAGFIELFQTPSHTKESMTNEKTTKVSYRASQPDLVDTPTSSK
PQPKRSLRKADTEEEFLAFRKQTPSAGKAMHTPKPAVGEEKDINTFLGTPVQKLDQPGNL
PGSNRRLQTRKEKAQALEELTGFRELFQTPCTDNPTTDEKTTKKILCKSPQSDPADTPTN
TKQRPKRSLKKADVEEEFLAFRKLTPSAGKAMHTPKAAVGEEKDINTFVGTPVEKLDLLG
NLPGSKRRPQTPKEKAKALEDLAGFKELFQTPGHTEESMTDDKITEVSCKSPQPDPVKTP
TSSKQRLKISLGKVGVKEEVLPVGKLTQTSGKTTQTHRETAGDGKSIKAFKESAKQMLDP
ANYGTGMERWPRTPKEEAQSLEDLAGFKELFQTPDHTEESTTDDKTTKIACKSPPPESMD
TPTSTRRRPKTPLGKRDIVEELSALKQLTQTTHTDKVPGDEDKGINVFRETAKQKLDPAA
SVTGSKRQPRTPKGKAQPLEDLAGLKELFQTPICTDKPTTHEKTTKIACRSPQPDPVGTP
TIFKPQSKRSLRKADVEEESLALRKRTPSVGKAMDTPKPAGGDEKDMKAFMGTPVQKLDL
PGNLPGSKRWPQTPKEKAQALEDLAGFKELFQTPGTDKPTTDEKTTKIACKSPQPDPVDT
PASTKQRPKRNLRKADVEEEFLALRKRTPSAGKAMDTPKPAVSDEKNINTFVETPVQKLD
LLGNLPGSKRQPQTPKEKAEALEDLVGFKELFQTPGHTEESMTDDKITEVSCKSPQPESF
KTSRSSKQRLKIPLVKVDMKEEPLAVSKLTRTSGETTQTHTEPTGDSKSIKAFKESPKQI
LDPAASVTGSRRQLRTRKEKARALEDLVDFKELFSAPGHTEESMTIDKNTKIPCKSPPPE
LTDTATSTKRCPKTRPRKEVKEELSAVERLTQTSGQSTHTHKEPASGDEGIKVLKQRAKK
KPNPVEEEPSRRRPRAPKEKAQPLEDLAGFTELSETSGHTQESLTAGKATKIPCESPPLE
VVDTTASTKRHLRTRVQKVQVKEEPSAVKFTQTSGETTDADKEPAGEDKGIKALKESAKQ
TPAPAASVTGSRRRPRAPRESAQAIEDLAGFKDPAAGHTEESMTDDKTTKIPCKSSPELE
DTATSSKRRPRTRAQKVEVKEELLAVGKLTQTSGETTHTDKEPVGEGKGTKAFKQPAKRK
LDAEDVIGSRRQPRAPKEKAQPLEDLASFQELSQTPGHTEELANGAADSFTSAPKQTPDS
GKPLKISRRVLRAPKVEPVGDVVSTRDPVKSQSKSNTSLPPLPFKRGGGKDGSVTGTKRL
RCMPAPEEIVEELPASKKQRVAPRARGKSSEPVVIMKRSLRTSAKRIEPAEELNSNDMKT
NKEEHKLQDSVPENKGISLRSRRQNKTEAEQQITEVFVLAERIEINRNEKKPMKTSPEMD
IQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEA
GNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKGTVAGTTILVCPNTEQA
LGKHE