GENSCAN 1.0	Date run: 14-Jan-104	Time: 22:59:30

Sequence FXYD4_1 : 7092 bp : 55.06% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1139   1228   90  1  0   87   99    22 0.228   2.80
ctgagattgcatcactgcactccagcccgggtgacagagtgagactccatctcaaaaaaa
gaaaaaaaaaaaaaaaaaaaaaaaaaaaagaagccaaaagagggtcttcggcccagcccg
cccctccccaacagccctgggtgtggcagggagcctgaccagttccctccagcctgcgtc
ATGGAGCCCTGGGCGTGGCTGCAGGGTTTAAAGAGCCGACCCACGTGCCCAGCAGCCTCC
TCAGATCCGTTCTCTGCGCTGCCAGCTCAG
gtgagccctcgccaaggtgacctcgcaggtgagcaggcgtccactttggggctgctgggt
gaagggggtgggtgcccaagaattctgagtaatgaggagcctgttgaggggtctgaggac
agatatggctgcagcagccgcttgaaggcctcctgctttgcacccactatcatatggatg

 1.02 Intr +   2286   2331   46  2  1   95  111    23 0.244   3.77
agtgctgggattataggtgtgagccactgcgcccggcctatggatgtatttattgtaaca
ggtttttagtgcttactgtgtgctaggcatagttcttaggcttgacaaatagtagttcac
gtaattccatcgctataaccttatgaggttgctactattctgatgatcctccttttacag
GACACTGGTGAAGGAGCAGTGAGGAACCTGCAGAGTCACACAGTTG
gtaagttgctaagaagggacccagcccagacagctggccctggatctgtgatctcatcag
gaggccagagctgggtacagcagatgatgacaatggcttcagtattgaaaacttgaccac
actaggctaacaatatgcagagggctgggagggggcctgcgctcaaagactcagcctccc

 1.03 Intr +   4029   4061   33  1  0   95   97    34 0.926   3.68
ggacagcagggcttgggcggggccacaccctgaggctgtgtggggctggggagggcgtga
ggaagggaactggtggctccagggtcaccccacaacctccgggctggggtcctgctgtct
ggcttacttggacaccagtgtcatgaattcccacacattttctctgctcctcccacacag
GCCTGACTGCCTTGGAAGCCAATGACCCATTTG
gtgagtgaggcccccaaacagcctgcccactctgcccacatctcccctctgacacccaca
tcctgtctcctggttctggttctgaagtctttttgccccactttttctagccaataaaga
cgatcccttctactatggtaagagctgatattcccacccccaccctacccttgcctatcc

 1.04 Intr +   4172   4198   27  0  0   76   95    20 0.511   0.07
tgaattcccacacattttctctgctcctcccacacaggcctgactgccttggaagccaat
gacccatttggtgagtgaggcccccaaacagcctgcccactctgcccacatctcccctct
gacacccacatcctgtctcctggttctggttctgaagtctttttgccccactttttctag
CCAATAAAGACGATCCCTTCTACTATG
gtaagagctgatattcccacccccaccctacccttgcctatcctggacctctttgctaga
caagttggtgaggggtagtgtggacctagtgtagacaaagtgggatgggggattaaacct
ggtctctgtgagagcgtcgctccaacaaggggagggtggccacaggatgcttaggaaccc

 1.05 Intr +   5058   5132   75  1  0   72   61    89 0.888   4.58
acccagcctcactttttttcttcttagtgtttccccacgagacgcagaatgatgcctctg
ttgctggcttgtctttatgtatatggcagcggctggcacaagcaggggctcaggagtgtc
ttttgaatgaatgactgaggccccaggctggtgcaagctcactctctgtacccaccccag
ACTGGAAAAACCTGCAGCTGAGCGGACTGATCTGCGGAGGGCTCCTGGCCATTGCTGGGA
TCGCGGCAGTTCTGA
gtgagtggcaggacaggtggggctggaggacagggtggggctggcggacagggtggggca
gaaagagagagtgctctcattccagcactgaccctggcgctgacccctctctctctccca
ggtggcaaatgcaaatgcaagagcagccagaagcagcacaggtgagcctgaccctatggt

 1.06 Intr +   5254   5293   40  2  1  123   99    49 0.919   7.27
gctgagcggactgatctgcggagggctcctggccattgctgggatcgcggcagttctgag
tgagtggcaggacaggtggggctggaggacagggtggggctggcggacagggtggggcag
aaagagagagtgctctcattccagcactgaccctggcgctgacccctctctctctcccag
GTGGCAAATGCAAATGCAAGAGCAGCCAGAAGCAGCACAG
gtgagcctgaccctatggtgccctcctccttcggggcagaactacggggggacagtcctg
acctggagagtggacagcatcctggccactcgctgggcttgcagctggctttgttattca
gatagtcaaccctgaagggccccagtcaggaaagctctgacctcggtattgtgggaagtg

 1.07 Intr +   5591   5628   38  2  2   70   94    41 0.475   1.29
tcagatagtcaaccctgaagggccccagtcaggaaagctctgacctcggtattgtgggaa
gtgaccatggaaggagagcaaggacttgcactcctggggccgggcagcaagagtctggga
tataggggagaaggtcctccaggctaacctgatactactctgatgtggtcctttctctag
TCCTGTACCTGAGAAGGCCATCCCACTCATCACTCCAG
gtgagacgggcttctgtgggctgagggggtgtctgtgtaaggactgtgtctgatggcctg
cccgccactctccgcaggctctgccactacttgctgagcacaggactggcctccagggat
ggcctgaagcctaacactggcccccagcacctcctcccctgggaggccttatcctcaagg

Predicted peptide sequence(s):


>FXYD4_1|GENSCAN_predicted_peptide_1|117_aa
MEPWAWLQGLKSRPTCPAASSDPFSALPAQDTGEGAVRNLQSHTVGLTALEANDPFANKD
DPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQHSPVPEKAIPLITPX