GENSCAN 1.0	Date run: 14-Jan-104	Time: 21:01:03

Sequence EGR2_1 : 6770 bp : 53.65% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1542   1921  380  2  2   62   31   453 0.469  33.40
ttgtttgctacttttatttctgttgatttttttttcttggtgtgtgtggtggttgttttt
aagtgtggagggcaaaaggagataccatcccaggctcagtccaacccctctccaaaacgg
cttttctgacactccaggtagcgagggagttgggtctccaggttgtgcgaggagcaaatg
ATGACCGCCAAGGCCGTAGACAAAATCCCAGTAACTCTCAGTGGTTTTGTGCACCAGCTG
TCTGACAACATCTACCCGGTGGAGGACCTCGCCGCCACGTCGGTGACCATCTTTCCCAAT
GCCGAACTGGGAGGCCCCTTTGACCAGATGAACGGAGTGGCCGGAGGTAAGCCGCGTGTC
TTCGCAGGCCCGGACCTGCGCGGCCCGGAGGTGGTGGATGGGGTGCAGTGGGTGTGCGGG
AATCGCAGGAGAGGATTGGGGCTCCAGGTGGACGGTGCTGACTGCACTGGCTTTGAAGAC
TGGAAGTGGGTGCAGGAGGAACCTGCGACAGCTGAGACCAGGGCGCGCGGGCAGATGCGC
CAGGTCGCCAGCAAACCGGC
gtgcgtgcgccccggcgcgcccagccccgggcgagcgcagggatgggggtggaagaggcg
tccccccgggtttcgaggcttgcgtaggccctctggccggcagcacttcgacctcccctc
tcccggggcaggggcaaagtgacggtaaagttcggggctctcggggagagctgcgcgcct

 1.02 Intr +   2985   3025   41  0  2   71   47    24 0.405  -5.05
ttttttattggggactagagccacagatggctgggggtggaggggagttgggaaaagctc
attctgcttttttggaggtagttcttgagttccatactgtcaatgggttgccacagttgg
gctggcctcttcttacagtctgtgggcctcaatttccccaccttttggactttgccacag
CTCTACAGTGCTGAGACTCTCGGCCTTGGAAATGGACCTAT
gtgagcgggggtgagaagggagtcctggctgtattttcattgttccacctccattctgcc
tttcccctccccagatggcatgatcaacattgacatgactggagagaagaggtcgttgga
tctcccatatcccagcagctttgctcccgtctctgcacctagaaaccagaccttcactta

 1.03 Term +   3100   4361 1262  2  2  122   50  1078 0.972  99.72
gttgggctggcctcttcttacagtctgtgggcctcaatttccccaccttttggactttgc
cacagctctacagtgctgagactctcggccttggaaatggacctatgtgagcgggggtga
gaagggagtcctggctgtattttcattgttccacctccattctgcctttcccctccccag
ATGGCATGATCAACATTGACATGACTGGAGAGAAGAGGTCGTTGGATCTCCCATATCCCA
GCAGCTTTGCTCCCGTCTCTGCACCTAGAAACCAGACCTTCACTTACATGGGCAAGTTCT
CCATTGACCCTCAGTACCCTGGTGCCAGCTGCTACCCAGAAGGCATAATCAATATTGTGA
GTGCAGGCATCTTGCAAGGGGTCACTTCCCCAGCTTCAACCACAGCCTCATCCAGCGTCA
CCTCTGCCTCCCCCAACCCACTGGCCACAGGACCCCTGGGTGTGTGCACCATGTCCCAGA
CCCAGCCTGACCTGGACCACCTGTACTCTCCGCCACCGCCTCCTCCTCCTTATTCTGGCT
GTGCAGGAGACCTCTACCAGGACCCTTCTGCGTTCCTGTCAGCAGCCACCACCTCCACCT
CTTCCTCTCTGGCCTACCCACCACCTCCTTCCTATCCGTCCCCCAAGCCAGCCACGGACC
CAGGTCTCTTCCCAATGATCCCAGACTATCCTGGATTCTTTCCATCTCAGTGCCAGAGAG
ACCTACATGGTACAGCTGGCCCAGACCGTAAGCCCTTTCCCTGCCCACTGGACACCCTGC
GGGTGCCCCCTCCACTCACTCCACTCTCTACAATCCGTAACTTTACCCTGGGGGGCCCCA
GTGCTGGGGTGACCGGACCAGGGGCCAGTGGAGGCAGCGAGGGACCCCGGCTGCCTGGTA
GCAGCTCAGCAGCAGCAGCAGCCGCCGCCGCCGCCGCCTATAACCCACACCACCTGCCAC
TGCGGCCCATTCTGAGGCCTCGCAAGTACCCCAACAGACCCAGCAAGACGCCGGTGCACG
AGAGGCCCTACCCGTGCCCAGCAGAAGGCTGCGACCGGCGGTTCTCCCGCTCTGACGAGC
TGACACGGCACATCCGAATCCACACTGGGCATAAGCCCTTCCAGTGTCGGATCTGCATGC
GCAACTTCAGCCGCAGTGACCACCTCACCACCCATATCCGCACCCACACCGGTGAGAAGC
CCTTCGCCTGTGACTACTGTGGCCGAAAGTTTGCCCGGAGTGATGAGAGGAAGCGCCACA
CCAAGATCCACCTGAGACAGAAAGAGCGGAAAAGCAGTGCCCCCTCTGCATCGGTGCCAG
CCCCCTCTACAGCCTCCTGCTCTGGGGGCGTGCAGCCTGGGGGTACCCTGTGCAGCAGTA
ACAGCAGCAGTCTTGGCGGAGGGCCGCTCGCCCCTTGCTCCTCTCGGACCCGGACACCTT
GA
gatgagactcaggctgatacaccagctcccaaaggtcccggaggccctttgtccactgga
gctgcacaacaaacactaccaccctttcctgtccctctctccctttgttgggcaaagggc
tttggtggagctagcactgccccctttccacctagaagcaggttcttcctaaaacttagc

Predicted peptide sequence(s):


>EGR2_1|GENSCAN_predicted_peptide_1|560_aa
MTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGGKPRV
FAGPDLRGPEVVDGVQWVCGNRRRGLGLQVDGADCTGFEDWKWVQEEPATAETRARGQMR
QVASKPASTVLRLSALEMDLYGMINIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKF
SIDPQYPGASCYPEGIINIVSAGILQGVTSPASTTASSSVTSASPNPLATGPLGVCTMSQ
TQPDLDHLYSPPPPPPPYSGCAGDLYQDPSAFLSAATTSTSSSLAYPPPPSYPSPKPATD
PGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGP
SAGVTGPGASGGSEGPRLPGSSSAAAAAAAAAAYNPHHLPLRPILRPRKYPNRPSKTPVH
ERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEK
PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGGVQPGGTLCSS
NSSSLGGGPLAPCSSRTRTP