GENSCAN 1.0	Date run: 14-Jan-104	Time: 23:09:50

Sequence AKR1C4_1 : 24514 bp : 38.56% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1234   1317   84  0  0   64   75   116 0.977   8.77
tggattcaattttcctcacagcctgtgtaatacaccatcacttgcttcctcctacatgcc
attgattagccccagggagcagtgcagcactgcctgcccatgttttacataacccctgaa
tataaatgccagatgttgctgaaggaaacaggatctgcttagtgaaagaagtggcaagca
ATGGATCCCAAATATCAGCGTGTAGAGCTAAATGATGGTCACTTCATGCCCGTATTGGGA
TTTGGCACCTATGCACCTCCAGAG
gtaataatcacattttcagcattgagcatttaaaagagcaaagctagaataagtgaacga
tgacctgggttgttcagctttgtgtttctgttaccctgagtgactcacgtggtctgtctt
actgggctagagctattctatgttcaaagagaaaaggtagtcaatgtttgttttgcactg

 1.02 Intr +   4547   4714  168  1  0  111   79   200 0.862  20.62
cgggtcatagtcccacaacctgcccccatctgtatgctcccctagaggtctgagcagcgg
gggcctgaagaagcgagccacacccccactgcacaccctgtgaggacaagggaacttttc
ctgtttcactacctctcaagcacattgatcaccaaatactacctttcgttgctccttcag
GTTCCGAGGAACAGAGCTGTAGAGGTCACCAAATTAGCAATAGAAGCTGGCTTCCGCCAT
ATTGATTCTGCTTATTTATACAATAATGAGGAGCAGGTTGGACTGGCCATCCGAAGCAAG
ATTGCAGATGGCAGTGTGAAGAGAGAAGACATATTCTACACTTCAAAG
gtactgtgcctatgatgagcatgtatgcacatgtgtttaatgggattgtgtggagatgac
aattctgtaactggttcagtagttgtgggtgaattgtgcttattagttccaatttattca
cacatattcaggtattaaagctaaaataaaaggcagagaatgatgatgcctttctcatca

 1.03 Intr +   8770   8859   90  0  0   76   97    27 0.681   1.67
atataggtaggtcatatcaaaataaaacaaagggaatttttgccagaggtcatctgtttg
gaacggtgaaaaatgtctaaatattaggtgaagcaaactaataaaactagctcatgtttt
tattcaacataaatcctttattttaccatgcagctttggtgcactttctttcaaccacag
ATGGTCCAACCAGCCTTGGAAAGCTCACTGAAAAAACTTCAACTGGACTATGTTGACCTC
TATCTTCTTCATTTCCCAATGGCTCTCAAG
gtagggaatttgtgagatcaacttctcttctgttctcagcatgaccatcctttatgatgg
ttgaattgaacttcttctaaggagggtgtaggtgttattacatggcagaagagtcctaag
tataatgcctaagccattttcttgaagagtacaaccttccttctgtaacgtatgatgaca

 1.04 Intr +  10123  10200   78  0  0   64  105    57 0.494   3.83
gaagcctgtctcctaaagacattccttaaaactctgtacgtgaaacacttggcccacatc
actttctagaacatttcagcacctacctcacggtggattattatcctaaaatgtacatgg
gagcatgcctatgggtggaaaagttaaatggtgacactaaagtgactgcttctacttcag
CCAGGTGAGACGCCACTACCAAAAGATGAAAATGGAAAAGTAATATTCGACACAGTGGAT
CTCTCTGCCACATGGGAG
gtgagtgcttggaggacagagtacagaaaaggaagacaagaagaggtaaacctgttcccc
agctttcatatgcaacattggaatatgcaccattggaactagaaattaaggagcttgaca
aaggaagttttgctgagtggtagggaagaatacatgactgaaatagaatagcaggaaatg

 1.05 Intr +  10641  10763  123  2  0  106   99   175 0.999  20.26
tacacaaattcttcttgctgtcactatccttttgttatctgttgtaattttttctcttga
gaatcactgctattttcattgtcatatcttaacagttgttgctttaacagttctgtcttg
catttatcataatctgcagccaactgcacaaataattcctcacaacccctttctccccag
GTCATGGAGAAGTGTAAGGATGCAGGATTGGCCAAGTCCATCGGGGTGTCAAACTTCAAC
TGCAGGCAGCTGGAGATGATCCTCAACAAGCCAGGACTCAAGTACAAGCCTGTCTGCAAC
CAG
gtgagcaccctcagcctcctctcctttctcttctcaatgtccatcttcctgtcctactgc
ctggcttccatttgttttgttccacttacatttgtgaaacagaagattctagaaagcaaa
acatctgtctagaagaaaacggaagacccttaattgcacctcttcttggagaagtcttaa

 1.06 Intr +  16982  17091  110  1  2   70   45   110 0.992   3.06
taacatttctatatatacttttagaccagtaatataaactgtatttttataaaatgattg
ttacttgacagtaatattctgttcaaatttaatgttatactttattcagcttattttaat
ctttatattaacatatctgttttgaattatctgatgcttttctctcttgatcatctaaag
GTAGAATGTCATCCTTACCTCAACCAGAGCAAACTGCTGGATTTCTGCAAGTCAAAAGAC
ATTGTTCTGGTTGCCCACAGTGCTCTGGGAACCCAACGACATAAACTATG
gtaataagagcatcaggaagtttacctaaaatgccattttgatgaaaaattttagttata
gcatactcagtctcctagagttcattctcaatgggtcagggtaaggggataatttgcatt
tcttatgagataccaggtgatgctgctgctgttcagggacctcacttgagaggctctggt

 1.07 Intr +  17360  17525  166  2  1  103   94   159 0.974  17.04
caatgggtcagggtaaggggataatttgcatttcttatgagataccaggtgatgctgctg
ctgttcagggacctcacttgagaggctctggtgcagaatgaacaccttagtctgtttagg
gagcctcctaccaaactgaatccagcctcaagacttcagcatttctggctttccttccag
GGTGGACCCAAACTCCCCAGTTCTTTTGGAGGACCCAGTTCTTTGTGCCTTAGCAAAGAA
ACACAAACAAACCCCAGCCCTGATTGCCCTGCGCTACCAGCTGCAGCGTGGGGTTGTGGT
CCTGGCCAAGAGCTACAATGAGCAGCGGATCAGAGAGAACATCCAG
gtgaggagttgggtgggcatcagggctcctgcacagtgtccttcacacgtgtgcttcttg
taaggttctcaggacacccttggactaagtccacttcctgggcatttcctatgcacaaat
gctttgtgtgcataagtgttttctactctaccacaggaggggcagcatgggtggagagaa

 1.08 Intr +  21077  21159   83  1  2   57   78   113 0.726   4.72
atttatattttatctgatattctttaatcacttgagagtttagagatggtctttcataac
ttttggaaacttatcaagtattttacatattgcctctacaccctactgtgtgatatactt
ggctattccaagttgacaattatgcaatctaagaataaacattttctacttctttggtag
GTTTTTGAATTCCAGTTGACATCAGAGGATATGAAAGTTCTAGATGGTCTAAACAGAAAT
TATCGATATGTTGTCATGGATTT
gtaagtaactttggaaaatgggtttcccagtttatttttagaggaggaatgtcagatggg
tgttgaaagtgacctcaataccagggagacagaggccagtgcaagtgagaggtgagacag
gaactctctggaactctccttctggattcactccagagctctgttctctgacagggtgag

 1.09 Term +  23084  23126   43  2  1   94   39    55 0.053  -3.15
ttttgaaaaaaaaaaaaaacacattataaactcatgttcatgaaagacattctacaaata
gtccgaaaataaacttcttaacattcacactaatggcagcttcatataaattcactttgc
taccagctttttaatagagtcatttcatccatatttatgtactatcctttctcttttcag
TCTTATGGACCATCCTGATTATCCATTTTCAGATGAATATTAG
catagagggtgttgcacgacatctagcagaaggccctgtgtgtggatggtgatgcagagg
atgtctctatgctggtgactggacacacagcctctggttaaatccctcccctcctgcttg
gcaacttcagctagctagatatatccatggtccagaaagcaaacataataaatttttatc

Predicted peptide sequence(s):


>AKR1C4_1|GENSCAN_predicted_peptide_1|314_aa
MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKMVQPALESSLKKLQLDYVDLYLLHFPMALKPGETPL
PKDENGKVIFDTVDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEMILNKPGLKYKPVCN
QVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDPNSPVLLEDPVLCALAKKHK
QTPALIALRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLNRNYRYVVMD
FLMDHPDYPFSDEY