GENSCAN 1.0	Date run: 14-Jan-104	Time: 23:09:33

Sequence AKR1C1_1 : 16940 bp : 37.25% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1170   1303  134  1  2   62   77   115 0.353   7.24
atgagtgtatcatgaccacataataatttacttatgaattttcttaggtaagaaacggtt
gaactggatgcaatttttatcacagcttgtgtaagactgcctctgtccctcctctcacat
gccattggttaaccagcagacagtgtgctcaggggcgttgccagctcattgctcttatag
CCTGTGAGGGAGGAAGAAAGAAACATTTGCCAGCCAGGCTAGTGACAGAAATGGATTCGA
AATATCAGTGTGTGAAGCTGAATGATGGTCACTTCATGCCTGTCCTGGGATTTGGCACCT
ATGCGCCTGCAGAG
gtaacaataatatttttagtgttgagagttcaaaggagctagagtaagtggaagctgacc
aggttgtcaggcttgtgttcctatgttactctgcatgactcccctttaaacgtcagtctt
tgttctgcaatgccatcttgtcacagggtcatctactgcttatttgtggcactgttttgt

 1.02 Intr +   3689   3856  168  1  0   65   79   228 0.980  18.82
tgcccaacctttattactaactgggaaagacccagggagactgggatgggctcatgattc
tacatacagaactcatccaagaaaggaggaaaagctgatttttgtgaacgtcgctacttg
tgcctgaactaactctcaggcacattagtcagaaaatactacctatggttactcccccag
GTTCCTAAAAGTAAAGCTTTAGAGGCCACCAAATTGGCAATTGAAGCTGGCTTCCGCCAT
ATTGATTCTGCTCATTTATACAATAATGAGGAGCAGGTTGGACTGGCCATCCGAAGCAAG
ATTGCAGATGGCAGTGTGAAGAGAGAAGACATATTCTACACTTCAAAG
gtactgtgcctatgatgagcttgtgtgcacatgtatttattgtgattgtgtggaggtggc
agttctatgactggatccatagtatagggtgaattgtgcttatttattacgatttattca
cacttactcatgtattaaaactaatatcaaaggcaggaagtgaagatggctttctcatct

 1.03 Intr +   4702   4818  117  0  0   78  102    46 0.964   4.74
acatattataaagttcatcatgatatggcagaacaaaaggcatcacaagaagagagagaa
taattttgcctgtggtcattagttttgaagtagtagaaaatgtctaaatattaggtggag
caaactagtaaaattggctcaagttttcattacacaacttcctttctctaacctctgcag
CTTTGGTGCAATTCCCATCGACCAGAGTTGGTCCGACCAGCCTTGGAAAGGTCACTGAAA
AATCTTCAATTGGATTATGTTGACCTCTACCTTATTCATTTTCCAGTGTCTGTAAAG
gtaggcagcttgtgtgatcaaattaatttcacttttgttctcagcataaatattgttttt
atggatatttgaactaagcattttcttaggaggacatagggattataacatagaagaaga
atcctaaatctaactcctaattcctttctatgggatacattttgaatccatacttccgtg

 1.04 Intr +   6084   6161   78  2  0   86  105    46 0.968   4.93
gcctgtcacctgaagacattccttataccttcatatgtagtacactctgtacataccact
ctctggagcactgcatcacctacctcatggaggattagtgtccttaaatgtacctcagag
catggctatgtgtggagaaattgacttgtgacatcactaaactgactgcttctacttcag
CCAGGTGAGGAAGTGATCCCAAAAGATGAAAATGGAAAAATACTATTTGACACAGTGGAT
CTCTGTGCCACATGGGAG
gtgagtgtttggaggtgagagaacggataagaaagatgaggtaggatacatctgtttcct
atcttcttagtacaagtatggaaaatgcaccattggatcaaaaacttaggaactttacaa
aggtagtttttgtgagcagtgaggaaaaagaaatgacaggcatacaaaagagagaagtgg

 1.05 Intr +   6597   6719  123  2  0   80   99   176 0.992  17.76
aggaaacagaaatacttactcttgcaatcactatcttcttccccaattttctgttttatt
ttttcccttttaagaaccacggctagctagttttattgtcatatctagacagttgttact
ttcacagttctgtgtcacatttatcttgatcttccacacctcacaattcctttttcccag
GCCGTGGAGAAGTGTAAAGATGCAGGATTGGCCAAGTCCATCGGGGTGTCCAACTTCAAC
CGCAGGCAGCTGGAGATGATCCTCAACAAGCCAGGGCTCAAGTACAAGCCTGTCTGCAAC
CAG
gtgagcaccctcagcctcctctcctttctgttcttcatgcccctctttctgtcctattgc
caagtatccattcatttagtcccacttatctttgtaaaagagaagattctagagagcaaa
gactctgtctcgaagggcatagagggatcttacttgtacccggcttagaaaagtcttaga

 1.06 Intr +   9976  10085  110  0  2  115   45   107 0.999   7.26
ttctattttcttaggagagaggggcataaaatttatttttatgaaaaagatcatttttga
caataatattctcagttcaaatttaatgctctacattattcagcttcttttactttggtg
attttaatattagtgtaacttttggattatctgatgcttttccatcttgctcgtctgcag
GTGGAATGTCATCCTTACTTCAACCAGAGAAAACTGCTGGATTTCTGCAAGTCAAAAGAC
ATTGTTCTGGTTGCCTATAGTGCTCTGGGATCCCACCGAGAAGAACCATG
gtaataagagatacaggaagtttacctaaaacaccggtttgataaaaaaaatttaatcag
atcatgctgtttcctggagttcactcacagctgacttggggtgagggaagaatttgcatt
tctgacgagatcccaggtgatgttgaggctgctgttcgggggcctcgcttgagaagctcc

 1.07 Intr +  10359  10524  166  0  1  132   94   233 0.990  27.34
acttggggtgagggaagaatttgcatttctgacgagatcccaggtgatgttgaggctgct
gttcgggggcctcgcttgagaagctccggtgcagagtggacgccttagtctgtttaggga
gccgcctaacaaactgtatccccagcctcagggcctcagcctttctgcctttccttccag
GGTGGACCCGAACTCCCCGGTGCTCTTGGAGGACCCAGTCCTTTGTGCCTTGGCAAAAAA
GCACAAGCGAACCCCAGCCCTGATTGCCCTGCGCTACCAGCTACAGCGTGGGGTTGTGGT
CCTGGCCAAGAGCTACAATGAGCAGCGCATCAGACAGAACGTGCAG
gtgaggagcggggctgtgggcctcaggtctcctgcacagtgtccttcacacgtgtgcttc
ttgtaaggctctcaggacagccttgggccagctccatttccctgtatttcctatgcatga
actctttgtgtacgtcataagggtttcttctactctagcacaggagaggcaacagaggtg

 1.08 Intr +  13626  13708   83  2  2   73   92    88 0.994   5.22
gcttatttttgactggttttcattgaccacttgggtgtttagagaggtctttcataaatt
ttggaaacgtatcaatcttttaagtattgtctctgcaccctactgtctgatgaacttggt
tgttcccaattggcaatgatgtaatctaaaaataattaaagttttctattactttgatag
GTGTTTGAATTCCAGTTGACTTCAGAGGAGATGAAAGCCATAGATGGCCTAAACAGAAAT
GTGCGATATTTGACCCTTGATAT
gtaagtaattttggagatggttgtcctaatttattttcagaggaggaacgtaggatgggt
gttgagagtgacctccacaccaggggcacagaggccaacgtgagacagaggtgagacagg
agctttctggaagtctcctcctggattcactccagagctctgttctctggcagggagagt

 1.09 Term +  13882  13990  109  1  1   96   47    96 0.540   3.30
ttgatatgtaagtaattttggagatggttgtcctaatttattttcagaggaggaacgtag
gatgggtgttgagagtgacctccacaccaggggcacagaggccaacgtgagacagaggtg
agacaggagctttctggaagtctcctcctggattcactccagagctctgttctctggcag
GGAGAGTGGCCTGGGGTCAGCATGGGTCAACCTGTGCCTCTGCTCTCGTGACTCCAAGGA
ACTTTCCAGAGCAGCCAAGATCATTGCTGAATCTGCACCTTCCATGTAG
gcctgctgtttgtgctactgtctagtgtacacactgtggatattgcccatgtggtcgcat
tagatgtttccaaatctgtgcttctatcttgttcttcccaacctgctcaatgtcttacca
gatcaaaggcagttccgtcaatcttgtgggccaggttccaattcccacctctttcacatg

Predicted peptide sequence(s):


>AKR1C1_1|GENSCAN_predicted_peptide_1|362_aa
XCEGGRKKHLPARLVTEMDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIE
AGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSL
KNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSI
GVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHR
EEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQV
FEFQLTSEEMKAIDGLNRNVRYLTLDMESGLGSAWVNLCLCSRDSKELSRAAKIIAESAP
SM