GENSCAN 1.0	Date run: 14-Jan-104	Time: 22:00:47

Sequence ACTA2_1 : 20080 bp : 41.78% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   5002   5153  152  2  2   87   94   151 0.887  14.56
ctgaaagcttatagtgtaactaaagtacttccagatacatgctatattagataagggtca
gaggatagcactaggacacagaggagggcccccaaacccagccttggaggtgggagttgt
caggtaagtgccacaaatgcccaattacagctgaggctgcttcctccctgttttctatag
AATCCTGTGAAGCAGCTCCAGCTATGTGTGAAGAAGAGGACAGCACTGCCTTGGTGTGTG
ACAATGGCTCTGGGCTCTGTAAGGCCGGCTTTGCTGGGGACGATGCTCCCAGGGCTGTTT
TCCCATCCATTGTGGGACGTCCCAGACATCAG
gtgaggaaaattatgattggaacataacaggacacagattaggttcctctgtgttcatgt
ttatccccagattgtctatctctttctgcccagaagttatgtaaccttgttacaaataga
cctctaatgattaaggtccaggagtaaatgccaatttcacatataatgtagacagattat

 1.02 Intr +   6569   6697  129  1  0   76   86   143 0.973  12.87
ttccaatcaactgcagaattttgcttaagagcatagtggcaatgagactcaatatgttta
ttgttgctgataatcagaagaggaacttcccatctcaatgacttaaccttttgtggcttg
gctgtaattgattcacaagttttgggagatgctgactcataatgtgttgaacctttttag
GGGGTGATGGTGGGAATGGGACAAAAAGACAGCTACGTGGGTGACGAAGCACAGAGCAAA
AGAGGAATCCTGACCCTGAAGTACCCGATAGAACATGGCATCATCACCAACTGGGACGAC
ATGGAAAAG
gtatgggaggtttgctgcagcttgggccctcaggatgcataatccctgtgttctctgata
cagaacaccacactactgctggggaaataactggctcacattgctcaactgtacttttac
ttgttaatgttcattctgggttattacccattgaaaaaaaaatccttgtagccataaaaa

 1.03 Intr +  10048  10158  111  0  0   57  108   115 0.991  10.06
gaaggtacttacacactttgagcttcagtctctgcatctataaaaccatggacacatgca
tgagtacttgtagcatttcctttggtcttggtttcaagtagcttctggtccctttttggg
aaatgcaggacctcatgacagcacatcattgtgtttctcctctgtcccccaactcactag
ATCTGGCACCACTCTTTCTACAATGAGCTTCGTGTTGCCCCTGAAGAGCATCCCACCCTG
CTCACGGAGGCACCCCTGAACCCCAAGGCCAACCGGGAGAAAATGACTCAA
gtaagtatgctaccccagcacacaacactgtggggtctggggaaacttctgttagaagga
ggctatgcagcacagcagagagaaggccggagctaggagtccaccaacagactaacagcc
ttcagtgaactcagggatcccaaaggacaggaacagcttgaaagtacttgcatccttcct

 1.04 Intr +  12086  12170   85  1  1  106   82    63 0.943   5.97
cattcacaccttcatttctcctctttaacgtgaccagggctgttctgaacctccttactt
tggcctcctctgcccagaacaggtcaggcccctctgcatccatcaaccaggtgtgctctc
ctgaccattctttgtcagatgggcaccttcactaactcagctctttggattgctttgcag
ATTATGTTTGAGACTTTCAATGTCCCAGCCATGTATGTGGCTATCCAGGCGGTGCTGTCT
CTCTATGCCTCTGGACGCACAACTG
gtaggtggctgggcgggacagcaagctggttggagcgcactgccagagatgggattgaat
ggtcgttaacacgtgggggtgacggactggagttgagttagaatggacacggctgaaccc
agccctaaaagatcttcttctagtgttcaaaataagcccttgatctcatatttctagcag

 1.05 Intr +  12565  12726  162  2  0   91   81   224 0.992  21.03
tactttttttcatcttccccgagccctgtcccacctcacctctcctatcacatgccctgt
tttctctttttaaataagaggctcggaaattccctctcccccaaggcttccctctacttg
tccagcaagtaaccacatgccagctgccatggtgacttatcacgcccaattgtctcccag
GCATCGTGCTGGACTCTGGAGATGGTGTCACCCACAATGTCCCCATCTATGAGGGCTATG
CCTTGCCCCATGCCATCATGCGTCTGGATCTGGCTGGCCGAGATCTCACTGACTACCTCA
TGAAGATCCTGACTGAGCGTGGCTATTCCTTCGTTACTACTG
gtgaggcctgtgggagataagggggagaggggagcagtgtgttgctcagtaacttccagg
accatcctcactatccaaggagatgatgggatgaagttttgcaaatggcaaggcctggct
ctaatgcacagagcaaagcacatctttctttgctgtgtgaagttgcaaaatgattacact

 1.06 Intr +  14257  14448  192  2  0   58   74   293 0.921  23.44
aggtggttccctggtggccctactacgtcattatcattgtggattttggattgcagaata
ttgaactgacacattttttgatggcacatgtcttgagggagagactgcagtagggcaggt
gaatctttgccacctgtgcagaccctaatgtttgccacaatgtttgtatctggttgacag
CTGAGCGTGAGATTGTCCGGGACATCAAGGAGAAACTGTGTTATGTAGCTCTGGACTTTG
AAAATGAGATGGCCACTGCCGCATCCTCATCCTCCCTTGAGAAGAGTTACGAGTTGCCTG
ATGGGCAAGTGATCACCATCGGAAATGAACGTTTCCGCTGCCCAGAGACCCTGTTCCAGC
CATCCTTCATCG
gtaggcaacaaacgcccttttcctgggaaggggagtcattgtcttcttccatatcaagcc
agcctccagaacatggagacaagtgacggttgccccaagaccaaaagcatttctaaacca
gaaaaagggaaagtgccacattttcaaggcgagaagacataatgaggccaggaaaaaggt

 1.07 Intr +  15713  15894  182  0  2  100   79   220 0.629  20.97
ggcaggaagacatagagcataacaagacccttttgtctctcagacaggtggttcctagat
tattatgtcttcccagcctcagtccactgcaagatcatccagatgttcaagtctggtctt
ccatgtctagcctgggttttactctccacttaaggaccatggcctgtgtctcttttccag
GGATGGAGTCTGCTGGCATCCATGAAACCACCTACAACAGCATCATGAAGTGTGATATTG
ACATCAGGAAGGACCTCTATGCTAACAATGTCCTATCAGGGGGCACCACTATGTACCCTG
GCATTGCCGACCGAATGCAGAAGGAGATCACGGCCCTAGCACCCAGCACCATGAAGATCA
AG
gtactgttcagtgacagacccagtggcaatgccgccagcagtgtcagccctataaccaca
gataagaactcttcagagactgtattttggtgacatgcaattgtgggttttaggggtagg
taatggacacaaatctcatattttacaggatgtaagtcaatctagttcataagaaaaatt

 1.08 Term +  18589  18732  144  0  0   83   41   134 0.905   5.13
tctggcggtcctgccaagaacatgacacaattaggacacaattggcatctaacagacaag
cctgtgtccctgctgaacaagaaactaggccatggtagaacatccaggctctgtcctacc
gcactaacgactgcactaatgatgacattaatgaccattctttttcatcttgactgacag
ATCATTGCCCCTCCGGAGCGCAAATACTCTGTCTGGATCGGTGGCTCCATCCTGGCCTCT
CTGTCCACCTTCCAGCAGATGTGGATCAGCAAACAGGAATACGATGAAGCCGGGCCTTCC
ATTGTCCACCGCAAATGCTTCTAA
aacactttcctgctcctctctgtctctagcacacaactgtgaatgtcctgtggaattatg
ccttcagttcttttccaaatcattcctagccaaagctctgactcgttacctatgtgtttt
ttaataaatctgaaataggctactggtaacttcttgcgttggcctccgatcaatactcga

Predicted peptide sequence(s):


>ACTA2_1|GENSCAN_predicted_peptide_1|385_aa
XSCEAAPAMCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK
DSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPL
NPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYA
LPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATA
ASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIR
KDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS
TFQQMWISKQEYDEAGPSIVHRKCF