GENSCAN 1.0	Date run: 14-Jan-104	Time: 16:29:42

Sequence XCL1_1 : 7859 bp : 39.38% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    660    800  141  2  0   53   59   117 0.528   5.48
atttgaaataagttggtacagcacagcttttcaaaagcttctataaatgtgtatgttaag
ttgtaataaagcaaacacatgcatgtagacatgcttaaacagttatttaattgtttcttg
ggtacctggggagatggggtgaagaaaggggggtgacttgaatgaaggtggaggagaaaa
ATGAGAACCAAGAAAGCAAAGGATCGAGAAGCTCAGTGTGGCAGCAGCCTCTCTTCCCCT
CCTGAGAGAGTCAAAGGGTGGCATCAGGGACTCATGATCCATGGTTGTGGAAGCCTCATG
TCACACTGGATGTCACATGAG
gtgggatggaacacagtgaccaccccacctcatttcctttacagcttccgtggtgggcca
tggcagtgaacagccttcaggcatgtctacggtggaagatctgaattcaggctggtggca
ggagacaacacaaccacgttttcttttatgcatgcatttggtttaattgacacattaacc

 1.02 Intr +   1388   1517  130  1  1   99   99    18 0.531   3.35
caggacctcagccatgagacttctcatcctggccctccttggcatctgctctctcactgc
atacattgtggaaggtaagtggagaagctgtctgtgagataaagaacagggaggcaaggc
aggtgggcacacattttgggtttgactcaggttatgactggactaacctgctttccccag
GGGAGCCTTAAACTTCCCATGTGCAAGAAAGGAATGATGATTTTGACTGTAGAGGGCTTC
GTAAACTTCCAAAACAGGGAGAATTTGATTAGTATCTGGGCTCCTACTTTTCCTAATTGG
GTAATTTCAG
gtaaattccttaaccactcagggcctgtgcttatttatgtataactgaatagtataacag
acatgatcacctgagattaagattaaataaatattatggtttatttaataacatcagatt
tccttacaagcagtaattttttgattaatgttagctatggattagaggtgatgattataa

 1.03 Intr +   4646   4760  115  0  1  107   82   128 0.994  12.69
atttactaagaatctgtgacgggcaagagattcgggatgcctatcagtcctctcttcccc
caaaaagcaaatggccttaaattctcacaacattctcagagtaatttaacagatgattgt
tcctgtgatctggataattgctttatttttaattgtctgttgtttttttttcctcaccag
GTGTAGGGAGTGAAGTCTCAGATAAGAGGACCTGTGTGAGCCTCACTACCCAGCGACTGC
CGGTTAGCAGAATCAAGACCTACACCATCACGGAAGGCTCCTTGAGAGCAGTAAT
gtgagtctgcctcctcagaagttgtgctgggtgggtatctagaagtatagaaatacactc
tgtagaaatgctgccgtcctcaggaaaagtaggtcagcatagaggaacacctcaacttaa
ccaaaaacctctttagttttccttatcaatcatgtctttctgcagcccaaccgaatagcg

 1.04 Term +   5635   5803  169  1  1  106   39   142 0.993   7.47
tcctttatgttaaaatagatggcagaagaagggtactcatttatgatctcatggctctga
aagactatttcttgcagtaatttctgcacaagatctcttcatgtctgccctgatcttaac
tcctgaccctgaggctttgagaatgtggctaacttcgtctgtcttttccttgcgttacag
TTTTATTACCAAACGTGGCCTAAAAGTCTGTGCTGATCCACAAGCCACATGGGTGAGAGA
CGTGGTCAGGAGCATGGACAGGAAATCCAACACCAGAAATAACATGATCCAGACCAAGCC
AACAGGAACCCAGCAATCGACCAATACAGCTGTGACTCTGACTGGCTAG
tagtctctggcaccctgtccgtctccagccagccagctcatttcactttacacgctcatg
gactgagtttatactcaccttttatgaaagcactgcatgaataaaattattcctttgtat
ttttacttttaaatgtcttctgtattcacttatatgttctaattaataaattatttatta

Predicted peptide sequence(s):


>XCL1_1|GENSCAN_predicted_peptide_1|184_aa
MRTKKAKDREAQCGSSLSSPPERVKGWHQGLMIHGCGSLMSHWMSHEGSLKLPMCKKGMM
ILTVEGFVNFQNRENLISIWAPTFPNWVISGVGSEVSDKRTCVSLTTQRLPVSRIKTYTI
TEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAV
TLTG