GENSCAN 1.0	Date run: 14-Jan-104	Time: 17:26:49

Sequence WNT2B_1 : 56265 bp : 44.90% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +  10173  10187   15  2  0   92   90    22 0.538   3.05
attaaaggagaaattagaaaataatttgaactgaatgaaaaggaagatgtaacatatcaa
tatttatgggacacagattgagtacttaaagagaaatttataacactaaatgcctatatt
aaaaaagaagaaagatataaaatcagttaagcaaatagaagttcaaatgacatcaccaag
ATGGTGGATGAGAAG
gtaatgcccatcccccactgagaaaaacaacgaataaacaactacataccaaccaaaata
gctctgggagagctgcagagtacaatgaaaaacttgcagcaacccaaaggaccacacaaa
ccaagatagccatattaaaaaatacagaaagtatcctacctactccaccccatcccccag

 1.02 Term +  10542  10916  375  2  0   33   38   160 0.271   0.24
ccccagtccaagcacagctttgcaccaagaggcatctcctggacacaacccacaacctcc
acctgtgggagaaaagtagagcaggaggaccccagcatcctttgccaccaatgcaaacat
tgaccacttttaccactgaggacccctgcagtttccaccagtgatgatctcaactgacag
AGCTTTCCAGGGTCCATGCTGCTGTGTCCCCCTGGAGAAGAAGCTGCTGTGTCCCCAGTG
GCCAAGATTACCAACTCACCGTCTCACAATTGCATGTATGCTCTAGACCCCAGAGCCAAG
GCTGCTACATGTATGATGGACACTTCTGACACTGGCACCACCACTGCCATGGGCACACCT
GTACCCCAGATCATAGAGCCATGGCTGTTCTGTGTGCAACCAAGCATCAAATACCAGCAC
CACTACCAACATGAGCACACCTGCACTGTGGATCTGGCACAAAAAGGGATCCCATCAGCT
GTGAAGTTCCCCCAAGCAGGAATAAGAGAACAGGAAAATGCCAGCAGCCTTTGCTGTTGC
ATTTGGGTGGGGTAG
tcaataataatttaccctatacatgtctttatatttagagtacccaagcaactttttctg
ctgctgtgtacacccacagccttggctgctgagggcctccagagccattggccatgctga
tctcagctgatggagctttatagagagtatgctgctgtacccaccatggagttggagctg

 2.01 Init +  35751  35942  192  2  0   86   53   135 0.700   6.77
ccgaatccccggtgtgtgtgcgcgcttcgtctgcaggtaggagttgtggtctggacagaa
gcaaagtaggccacactcgcctgcccttgggaacacccacttctccgtgccacgcccgct
cctaaggttttcttcgggcagaaacgcggggatccccaagaagacgaagctcaggctgcc
ATGCCTTTCCCGCGAACGCCACGGCGCGGCGCCCGGTTCACAGGGCGAGTCGCCCACCCG
CGAGTCGGAAAGCGCCCGGAATCTTGGCTAAAGCTCAGCGTTCTCCTCCGGGGCTGGGGC
CCTGGCCAGGCCTGGCCTGAGCGGTCTCCCCTCACTCTGCGGCTCGCTCTCCCGGGCTAC
TCCGGCGCGCAG
gtgctgcgcccgcgggagagagcgatcctgcggccgtggcggacgccgggaggagccacc
gggctctcctctcaggagcgcgtccccgtgccctccagctgcccgtccctgctgaaagca
tccggacagctccccgggccgcggccctggggcccgccagagccctgccctgcaccccgc

 2.02 Intr +  36041  36258  218  1  2   71   90    96 0.665   5.40
gggctggggccctggccaggcctggcctgagcggtctcccctcactctgcggctcgctct
cccgggctactccggcgcgcaggtgctgcgcccgcgggagagagcgatcctgcggccgtg
gcggacgccgggaggagccaccgggctctcctctcaggagcgcgtccccgtgccctccag
CTGCCCGTCCCTGCTGAAAGCATCCGGACAGCTCCCCGGGCCGCGGCCCTGGGGCCCGCC
AGAGCCCTGCCCTGCACCCCGCTCTCCCCTCTCTGGCCCGGAGGGCTGCGCCGGGCAGAT
CCTTTCCTCTGCAAGACAGAGACAAGCAGCGATAAACAGCTAAAGCTGGAGACCCGGCTA
AATGATACAATAAGTTCTCTAATTGCCTCGAAAATAAG
gtaatgatttggcagagggaatgctttgatcttatcaggcaagagagacctctccaaagg
aaacctcagagaagggctggaggcctcggacttgggggtgtgaagcccaaggacagcctg
ctttccccgccctcccccgaccctgcgtgtccacggtccccagcctcaccctccggcttt

 2.03 Term +  39290  39314   25  2  1   94   38    30 0.174  -3.70
tttattatatttccatgaaaatgccttgggagtaatgccttttgctccttgttatttagg
ataccctggccagtgttgggcacacagcaggtgctcagtaagtgctgacttgactccatg
cagggttctacagaccagaacttaactctgagatcagtgactcctccctctggctcccag
AACTGAGAGTGAGAGTGTGGAATAA
aatgaagatgcaggtcaggagctagcttgagcctctggccttgaccctctgcctggcagc
cccacaacaagcctttgcgtgaggagctgagctctccagtagtgtctaggaccttgagac
tggaagtttattttgagatttgaagctccaaagaggcagatcccagaaaacctcttctct

 3.01 Init +  43046  43227  182  1  2   63  103   246 0.873  20.26
aacttgcgcccctctcggggatcctcctcccgggctctggaccccaggtgatcctaggtc
cccagccgccggcgaacaccatggccccccaggggggtgaggtaggagcagcctgagtac
ccccagaaggtgccccgtccacgcccctccgggctgcgcggcgggagtcttcggggagct
ATGCTGAGACCGGGTGGTGCGGAGGAAGCTGCGCAGCTCCCGCTTCGGCGCGCCAGCGCC
CCGGTCCCTGTGCCGTCGCCCGCGGCCCCCGACGGCTCCCGGGCTTCGGCCCGCCTAGGT
CTTGCCTGCCTTCTGCTCCTGCTGCTGCTGACGCTGCCGGCCCGCGTAGACACGTCCTGG
TG
gtaagtgtggctctcaggctgggcgggtgaggcgcttggtaggagaggccggaggcgcct
ggagggactggctgctcacgggaccaggctgttgcttcgacgggttggagacgattcggg
caggactgtcactgaaatctgaagtcgcggggtggcgggagggtgaggcgccgcgtctta

 3.02 Intr +  48657  48877  221  0  2  108   63   341 0.993  31.55
ctattaatacttcttcagaactgtgggaaatggttctactcatcagctttatggaatgtg
ggttagggagaggggacagaatctcttcaaggtctggatgctaaacgtaccccttcctta
ttccctcccaatgcagaaaaaggtctgggatgttctgacagggccatctctgccttgcag
GTACATTGGGGCACTGGGGGCACGAGTGATCTGTGACAATATCCCTGGTTTGGTGAGCCG
GCAGCGGCAGCTGTGCCAGCGTTACCCAGACATCATGCGTTCAGTGGGCGAGGGTGCCCG
AGAATGGATCCGAGAGTGTCAGCACCAATTCCGCCACCACCGCTGGAACTGTACCACCCT
GGACCGGGACCACACCGTCTTTGGCCGTGTCATGCTCAGAA
gtaagagcctcttccatcctgtgtcagctccttccctttctgtgctgggggtggtgagtg
ggaagagtaggcaagatctcccctctcctctcccacacactgtttcatcatcagagaaag
aactgtgggcagagcccaggatataattgggaacagactcttagcatcttagatttgtag

 3.03 Intr +  49923  50218  296  1  2  110   75   344 0.612  32.03
ggtcagatactctggggaatgctcttggaaatgaaaggcaccttgaataaagggggtgta
ggggtgactctgggaaagaaaattagggaagaggtttcagagtcagaggttgtatgggct
gaagaaggggacagacatgggcctctttcctgaagcacacctctacaattctctctctag
GTAGCCGAGAGGCAGCTTTTGTATATGCCATCTCATCAGCAGGGGTAGTCCACGCTATTA
CTCGCGCCTGTAGCCAGGGTGAACTGAGTGTGTGCAGCTGTGACCCCTACACCCGTGGCC
GACACCATGACCAGCGTGGGGACTTTGACTGGGGTGGCTGCAGTGACAACATCCACTACG
GTGTCCGTTTTGCCAAGGCCTTCGTGGATGCCAAGGAGAAGAGGCTTAAGGATGCCCGGG
CCCTCATGAACTTACATAATAACCGCTGTGGTCGCACGGTCAGTACTCATGTCTGT
gtaagtacactcatatttgctgggggtgaccagtgtgtgtgaccatggactaaataaatg
tgaagatggaagagctgaaggcttctgggtcacttccaaaagccccaacatcctgggaca
ggagaactaaatgcaagggagcttaggaatgcctagggtcaatcaggtgcgtgaagagtc

 3.04 Intr +  50904  51168  265  2  1  127  109   235 0.750  26.59
tttcttgaacttgatcaggaagaatgggtgggatctgatgtgggagagaaccgagagctc
aatcggccagccagggccaggtccagcctatctcagagcactcatccttttggacctagg
gatgactaaaatgtgtcctgaccagctacttctcccttaactgccttccccctcccccag
GCTGTGCGGCGGTTTCTGAAGCTGGAGTGTAAGTGCCATGGCGTGAGTGGTTCCTGTACT
CTGCGCACCTGCTGGCGTGCACTCTCAGATTTCCGCCGCACAGGTGATTACCTGCGGCGA
CGCTATGATGGGGCTGTGCAGGTGATGGCCACCCAAGATGGTGCCAACTTCACCGCAGCC
CGCCAAGGCTATCGCCGTGCCACCCGGACTGATCTTGTCTACTTTGACAACTCTCCAGAT
TACTGTGTCTTGGACAAGGCTGCAG
gtgagtaaggaaggcaggcagggacatgcagtcccagttcttagtgcaggcacccctggt
taatcatggtctgttcagtctcaggagttagggaagggggtgctgtgggaggaggcagtt
tcctctccacatgaacacctggtcatgagattgttgcagtccaccaggcccagtgctgcc

 3.05 Intr +  51822  51899   78  1  0  -25  103   104 0.361   0.12
taagctgctccttgaagtgtagggagtatctggatagcttgagagacgagtgggcaattt
cttatcagagagtagtaggtgggaaagcacatgatctgtcccagggacagagaacagacc
aatctgctgggtaaaggttctctctaagggagattaaagctagaaagatgtccttgaaag
GCTTTATCCAGTGTGCTGCCATTGAAGATTCTGAAACAGCTGAAAAAGAAACGAAGAAGA
GATCCCTACCAAAGGCAG
gtaaagcagcaaatggttgtttttcagtctgttcgaggtatttgtggtgggattcttgga
ggtgctggaagttgatatggtttttccccaagggaatgaaagttaccatcctggctcaca
tttctggttcagataggttaaactaggaacatgcaatgcagcagaactcttctcctctgg

 3.06 Term +  54063  54292  230  1  2  101   47   177 0.981  11.69
ggactcaaggattccttctgccttggccttccaaaatgctgggatgataggcatgagtga
gccactgtgcccagcccaaaaaagcgattctttttatcttccttctgagaatgtggttaa
gggtatccagggcagctgaagagataactttgttctcactccctctcttccccaacccag
GTTCCCTAGGCACTGCAGGCCGTGTCTGCAGCAAGACATCAAAAGGAACAGACGGTTGTG
AAATCATGTGCTGTGGCCGAGGGTACGACACAACTCGAGTCACCCGTGTTACCCAGTGTG
AGTGCAAATTCCACTGGTGCTGTGCTGTACGGTGCAAGGAATGCAGAAATACTGTGGACG
TCCATACTTGCAAAGCCCCCAAGAAGGCAGAGTGGCTGGACCAAACCTGA
acacacagatacctcactcatccctccaattcaagcctctcaactcaaaagcacaagatc
cttgcatgcacaccttcctccaccctccaccctgggctgctaccgcttctatttaaggat
gtagagagtaatccatagggaccatggtgtcctggctggttccttagccctgggaaggag

Predicted peptide sequence(s):


>WNT2B_1|GENSCAN_predicted_peptide_1|129_aa
MVDEKSFPGSMLLCPPGEEAAVSPVAKITNSPSHNCMYALDPRAKAATCMMDTSDTGTTT
AMGTPVPQIIEPWLFCVQPSIKYQHHYQHEHTCTVDLAQKGIPSAVKFPQAGIREQENAS
SLCCCIWVG

>WNT2B_1|GENSCAN_predicted_peptide_2|144_aa
MPFPRTPRRGARFTGRVAHPRVGKRPESWLKLSVLLRGWGPGQAWPERSPLTLRLALPGY
SGAQLPVPAESIRTAPRAAALGPARALPCTPLSPLWPGGLRRADPFLCKTETSSDKQLKL
ETRLNDTISSLIASKIRTESESVE

>WNT2B_1|GENSCAN_predicted_peptide_3|423_aa
MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLTLPARVDTSW
WYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTT
LDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQR
GDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTVSTHVCAVRRFLK
LECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRA
TRTDLVYFDNSPDYCVLDKAAGFIQCAAIEDSETAEKETKKRSLPKAGSLGTAGRVCSKT
SKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCKAPKKAEWL
DQT