GENSCAN 1.0	Date run: 14-Jan-104	Time: 15:08:33

Sequence TP73_1 : 83127 bp : 59.76% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.02 Term -    202     38  165  1  0  100   46   145 0.689  10.37
 1.01 Init -    646    308  339  1  0   38   70   148 0.414   3.50
 1.00 Prom -  10371  10332   40                              -1.06

 2.04 PlyA -  10519  10514    6                               1.05
 2.03 Term -  10901  10812   90  2  0  126   49    86 0.976   7.14
 2.02 Intr -  13344  13144  201  0  0   61   26   116 0.549   3.40
 2.01 Init -  13560  13558    3  0  0   70  101     0 0.680  -0.44
 2.00 Prom -  15223  15184   40                              -1.06

 3.01 Init +  18724  18862  139  0  1   51  110   146 0.146  11.53
gaataggtgtgtccatgtgcatgtatgtgcaagtgtgttgctagaggtgagagggtgggt
agggaaactgagtgaccagctcctccctgaagccttgggggaatgtccgaggggccaggg
cctctggatcctgttcccttggctctttgcaaagtctccagcctggcctcctggatgggc
ATGTGGCTCGGGGGGCGAGACCATGGGCTCTTCCTGGCTTGCTGTGTCGCTCTGGGTGCG
TTTTACACCACTCTGAGGATCTCTCTGCTCATCCCTAAGGCAGGGATGATGATGGGGCCA
GGGGACCACATGGGCACAG
gtaaggcagggatgatgatggggccgggggaccacatgggcacaggcttctggaatgtgg
gtgtcgtctccctggggtcccgcagtctgaactcaagactcaagagccccatgtccaggt
ggggatgtacaggagccccttagaagtggggaagaaggccaggcgtggtggctcacatct

 3.02 Intr +  21945  22067  123  1  0   87   66    33 0.025   2.73
gtttcgaggacgcctcattccctgagagactgaggataggctggtgctctgcaaaagggt
gcggagaccactgtaaaagtggggtgagacacgcgtgctgaccatgaaatggagaggcac
tcgaaggagccagggacccggcagccagcagaccccacctttccgcccccgtgtgtgcag
TTCTGTCGCTCAGCCTGGTGCCTTTGGGACCCGGGCCTCATTGGTTCTTCCTCCACTGCC
ACCACCTGATACTAAATAACCGTCGGTCAATGGCAACTCGATACGGTTTATGGGGCATCC
ACG
gtgtgcccagatagaggagtgctttcgcttttgatatgcgtagagttacttcattccacc
tagcgcttctaggaggcactacaattatctccattttacagacaaggaaacagaggctca
gaatgggcaagacatctatctgaggtcacacagctagagcgcggcagaggtgggctgcgt

 3.03 Intr +  25565  25638   74  0  2   43   85    31 0.048  -1.42
ctggggcagggttggcgtgtgagcctgaggccctgcaaagtgcctggccagcctcagctc
ggagccatggcacagcaccccctctccgccacggccccgacagctgggcgtgcgttctgc
tgtgggcagctgccctgagcaacgtagggtgctaagcagcatccctgtcttgcacactag
ATTCCACAGCACCCTCTGACCCCGTGGAAAATGTCCCCACATGGGAATATCCTCTGGGGG
TGGAACTGCCCCTG
gtgagaacccctaggctgagacctcagaaggccctgagtcaaaccgagaagtcatcagag
agccttgttttcagctccagggagcttgggcaggctggttttctgggccacacagtcccc
tccccagcccacctgtgctccgtgggtcccggggaagctgtgggggcctaattgctggtg

 3.04 Intr +  27013  27072   60  0  0   64   89    32 0.085   0.97
cttgtgaacgaattttcaaattaaaaggcaaatggttgggaaaattggatttaattgaaa
ggccattttattagaattgacttatttttctcgccactgggatccttgcctgaaaggcgg
ctgtgggcagagggcacatactccccctgccccagcgcagcgtccctgcacccccaacag
AGCTTCCTGTTCCTCATGCCCAGTACTCCCAGATGCCTGCGGAGCCAGTCATCAGCTCAG

gtgtgtgaggccggttgggggagcccctgcctggcgcctgtgcctgtgagcagtgttcct
gtggggccctgggaccaatgctaccagcgttggcgttttcccaggaagttgggaatcagg
catctcgtggcttccggttcaagttcctccgtgtgctttaagtctgggcaggtttccggg

 3.05 Intr +  29759  29866  108  1  0   71   42    48 0.167   0.15
cagccgtgtgacctcacacaagtcacttaacccctctgagccttggggctcctgaaaagt
ggatggagcggtcacgcccacctgggagaggtggcttgggccagcaccctctaagctgct
tgtcccaggccatcatggctcacggaccgcccctcagcctggcctgtgccacttctccag
GGCCCGGCACGTGGCAGCCACAGGCTTCTATCAGCTCCCGCCTGCCTGGGGAAGGACAAA
AACGACAGGTTCCAGGCCATGGCCTGCACCCCCGCTGGCCGTGGGCAG
gtccaggcctgcctgcctgagcattgcagggcggtggccaagcctgtcccatagcacctc
accgaggacctgggaggctggcccaggggagaggtcacctcagccggggctgggggctgt
gggcagggtgggctcgggtttccctgtcccctcccccagctgtgctctgcctggacactg

 3.06 Intr +  30969  31066   98  2  2   99   65    84 0.822   7.17
ccgcggggaacagggtggacgaaatgacagtggagagggcacagggagggcaaggcgggg
gcacctgctccagggatgccccaggcaggcccacttgcctgccgcccccaccgaggctgt
cacaggaggacagagcacgagttcccagggtgctcaggtgtcattccttccttcctgcag
AGCGAGCTGCCCTCGGAGGCCGGCGTGGGGAAGATGGCCCAGTCCACCGCCACCTCCCCT
GATGGGGGCACCACGTTTGAGCACCTCTGGAGCTCTCT
gtgagtgcgcttggctggccagagctgggggcccccctgggaggcactctgggctagcct
cagccaccttcgctgggctaactgggccagagcaggaggggtggccccgggaggactctg
ggctagccccagccaccctcactgagactttgggctaaacttggcaaccctcactgggat

 3.07 Intr +  31696  31816  121  1  1  116  101   139 0.995  19.67
actcacagcagccctggaatggcaggtggaggacagagatgggatgagagggaatgggaa
gggcaggagacgtaggcctcaccaggagtctcaggctagccttgagctctgggcctggga
ggtattggggtgacacccaaactggggactgacgcttctattttcctctccctgccccag
GGAACCAGACAGCACCTACTTCGACCTTCCCCAGTCAAGCCGGGGGAATAATGAGGTGGT
GGGCGGAACGGATTCCAGCATGGACGTCTTCCACCTGGAGGGCATGACTACATCTGTCAT
G
gtgagtgggggggctgccctctgcaagaggactggagtggggacaacaaatgtggcctgt
cctgtcttgggagcctggcagaaccaggagatagcctcttggttgtacagcttcccctgt
gggtttctgaggacacttcaaattgcaaaggagaaaatgtatcagctcatgtaactgtca

 3.08 Intr +  37092  37169   78  2  0   28  117    37 0.283   1.50
cccaggtctcagagccttgcagcttctgcggcctcttccatgcggtgggatgaagccagc
tgcccagcagggaccctgtgccatgagtttggccttgaactgacacatcactggcaccag
gaaacgaagtccccctgtctgttctggcacataacccctcccactaactggttcctgaag
AGTGCCGTGGCCTGCGGCAGCGTCGTTCCCCCCTGTCCTGCGGCCCAGGGTCCTGCGGAA
AGTCAGGCGGAATCCCCG
gtgagtcagaagcagaatgaaagcagaatggaggacccagcagggagggaacctggagga
ggcgctaagggccacgccaagggggtgtggccccagatcccctgtccctgtcctctgcaa
ggctgggccttgggaacgtttgcagaaagctgggtgccgctctggggcagaggccagtgg

 3.09 Intr +  38060  38142   83  1  2   91   44    21 0.082  -2.41
gccgaccccctgcagggggcttcccagagacgcccttcctgaacctgatctaccagacaa
aactgtctttttctcagtcgtctcctcctgagtgctgctgcccttcctgttgggggctga
gatcctctgccacaggaagagacgggcgtccaggactcacctgctgcctcccggccctag
GGCCCTGAGCTGGGCTCTCCAGGCCCCAGCCCCTTGGGGCACAACACCTGGAATCGTCCT
TTCGTCCTCAGCCCGGCCTGCTG
gtggggcagggcgggtccccagggctcctcaggcagctgcagtccaaacctcccctgccc
tcacccagctctgcccgctctcccgggggtgggggtggggagcgatgaggcccctgccgg
ctctcggtggggacgacagggaggaaggaagctggggagatggagacaagagaaagcagg

 3.10 Intr +  39407  39580  174  2  0   66   90   101 0.196   8.36
tcaccgggcaagctgaggcctgccccggacttggatgaatactcatgaggaataaagggg
tgggccgcgggttttgttgttggattcagccagttgacagaactaagggagatgggaaaa
gcgaaaatgccaacaaacggcccgcatgttccccagcatcctcggctcctgcctcactag
CTGCGGAGCCTCTCCCGCTCGGTCCACGCTGCCGGGCGGCCACGACCGTGACCCTTCCCC
TCGGGCCGCCCAGATCCATGCCTCGTCCCACGGGACACCAGTTCCCTGGCGTGTGCAGAC
CCCCCGGCGCCTACCATGCTGTACGTCGGTGACCCCGCACGGCACCTCGCCACG
gtaggtgtgacgcgccattcataggatctcttcggggactttgcgggggattttgctgca
gtgtagggttcagaggggcatccttctgcctgccttcctggcctggagtctgctgccagt
tggggtgagcagaggtaggaagggaggcgttgaggggctagaggcaggtcccaggcatgg

 3.11 Intr +  40368  40552  185  0  2  105   61    45 0.045   4.14
cttggaagaggggagggaagggtctgcagcttgtggttggcccctgcagcctgagccctg
gggacctggcctcacttccagacttgccaggtccctgggggccaggcaggcaccagctgc
taattgagaaggtggaaggctcggcacagctgctccacgtggggccgttcctcctcccag
GGAAGCAGACAGCTGGGACCATGGGTACCTGTGCCACACGGGAAACTCAGCCATGGGCAG
GGGGCAGCGGGCAGATAGGCAGAGTCCAAGTGCCCCGAAGCTCTGCTGGCACTGGGATGT
AGAGGCCCAAAGATCTGGGGACGGAGGCCTTTGGAGCCGTGGGCTCCCCAGGCAGTGTGA
CCAGG
gtgtgtgtgacagcgatgtgtgtgagcgtgcacatcaatgtgcatgtggcgggtgggtat
tggtgtgcgtgcatgtgtgtgtctaagcgtggatgtgcatgcaatacgcaggcgaggata
tgtgcagatgtgtgtgtgtatgttatgggtgtgtgtacaggctggtgtgtgtgtatgtac

 3.12 Intr +  41513  41630  118  0  1   45   10    98 0.009  -1.60
tggccagccgagaagcctggggacctgggggactctagtacaatcttttcccttgaatgg
agcagatgtcaccatgtgactcaccctctcgggggactccaccaaggttgagtatgtggt
tgcgcagacgccattcccgggaggggtggggaggtggagccctgctgccctggcctgcag
ACCCTCACTGCCTGCAGGAGCTGCTGGTGTCCACTCGGCTGCTGCTGCCCGGTGCCCTGG
GCGTCAGCAATGGCCAGCTGTGCCATCACTGTTTCTTTTTACACCAAGGATTACTGTG
gttcgttcgttcatttgtccattcattcatcccatcagcaagtgttaactgggcacgttt
tgtgtgttaggctgagtgccaggagcaggtggaggcagtgcccagagccagccatgtctc
cagcacctcttccctctcggggggaggtgggctaggctgggccatcctaatgggcggagt

 3.13 Intr +  46102  46219  118  1  1   97   18    54 0.005   0.94
agccccgggcgtctctgctcagctccgaccacctctcccgctatccccctgggctccgtc
tctccctgcacaggccctcggcccttcctctggctgcaggctctctgccctgctggtccc
cagcctggaaacacccccaggcccacccaatacctggggcagatctttcccttcctgcag
GCCCGCCTTCACCTTTTCCCGAGCCCGTCCTTGCCTGGACGCCAGCCCTGGCCCCTGTGC
CTGGCTCTGTGTTTCTGAGACCACTTTTGATCCCAAGCCCCTGCACGCTTGCTGGCTG
gtttgtttactgtcgtcagcatggagggccggggtcgtgtctcgtgccggctgccatctt
cctgcacctgggagggtgctaggatgtcaagcctaggaaatgggtgtgaagaggagacct
gcctttgcaggagctgaccaaggccagtgcactgggcgggaccatccgtcactcctgagc

 3.14 Intr +  46512  46582   71  2  2   83   23    83 0.001   0.43
ggagacctgcctttgcaggagctgaccaaggccagtgcactgggcgggaccatccgtcac
tcctgagcccactaactggggaggggacaggcagagcggggctgggtgattcctgagcaa
gcatgctgctgtctctctggctctggggcctctgccctctgcctcgatggccccccacag
CCGTCCTGGACCGCCTTCTCCACCTTTGGGCTCCTGCTCCAATGTCCGCTTATCACCGAG
GGCCATCGGAG
gtggcacgccccgtgactgcctccccctccctgtaccctgcactgcacgtgtcataattc
aagttctcggctcagccacccattctcggctcagccactaatgtgtgctggaaggtgtcc
aggaagccctgctaagcatctgtcagtgtctccagcacagcaggaggctgttacaggtgg

 3.15 Intr +  55912  55999   88  1  1  102   53    57 0.877   4.73
caccctgcactcagggcccacttgtgcccagcccacctcccccactgcctggctccctgg
ggctggatctccccactttgagctgtgaggtccagaccccgatgccgcccggagggtaca
gtgaagcccgtgtgggcatcagggcctgggagcctcccccacccgacgcctcccctccag
GTGTGCAGAGAGTCTATTCCGCCTCATCAACGGCTGGGTGGATCCCCAGAAACCCTGGCA
CCGGGAGGCTGATGGAGGGGAGGGCGAG
gtgaatatgtcagtttatcccaatgcaagtagtggcctgttgggatgggggagagacccg
gggaaatatttgggatgactggagccgctggccctttaaggctcctgtaacaggacacct
cctagacgggacaggacgactgactgtgtgtgtttccccctccctcctcccctttcccgc

 3.16 Intr +  56185  56427  243  0  0  101  113   305 0.905  33.23
tatgtcagtttatcccaatgcaagtagtggcctgttgggatgggggagagacccggggaa
atatttgggatgactggagccgctggccctttaaggctcctgtaacaggacacctcctag
acgggacaggacgactgactgtgtgtgtttccccctccctcctcccctttcccgcgccag
GCCCAGTTCAATCTGCTGAGCAGCACCATGGACCAGATGAGCAGCCGCGCGGCCTCGGCC
AGCCCCTACACCCCAGAGCACGCCGCCAGCGTGCCCACCCACTCGCCCTACGCACAACCC
AGCTCCACCTTCGACACCATGTCGCCGGCGCCTGTCATCCCCTCCAACACCGACTACCCC
GGACCCCACCACTTTGAGGTCACTTTCCAGCAGTCCAGCACGGCCAAGTCAGCCACCTGG
ACG
gtgagttcccctagtccctgagggctgcgggctgcgggctgcgggctggagaggaggtgg
ctgcgttccccgcacctcaagaggtctgagctcgccccactgtctgctcggggttcccac
ctggcccgggccaggaggagcatcgggcaggaggcgggtctcagggccgggcagtctggg

 3.17 Intr +  70657  70843  187  0  1   97  100   316 0.973  34.17
ttcacgcctcaaaggacagacacctggagggattcagcagaggggctgcttggggcagtc
ttcatctgggggttgtggaaggggcacccatggggaggacgtggctcccaatggggggtg
gcctggacaggggtgcagttgggaccactggtctcacccgctccctctcccccactccag
TACTCCCCGCTCTTGAAGAAACTCTACTGCCAGATCGCCAAGACATGCCCCATCCAGATC
AAGGTGTCCACCCCGCCACCCCCAGGCACCGCCATCCGGGCCATGCCTGTTTACAAGAAA
GCGGAGCACGTGACCGACGTCGTGAAACGCTGCCCCAACCACGAGCTCGGGAGGGACTTC
AACGAAG
gtgagggcccccagctcctctgcccacggtggcactttgcccagcatcccggacagcaca
gccgggggctgcctaactgggagagagtggggctgacagcatgggcttagccattcccct
gcggagggctttcagtgcctccaccagcccccattttcccagttctgagtgggacctggg

 3.18 Intr +  71990  72105  116  0  2   66   96   183 0.997  18.24
tctgcacctgacatggggctgggcacttctttgaacctggcacggggctgggtacctctc
tgcacctgacatggggctgggcaccctttgaacccggcacagggctgggcacctctctgc
acctagcacaggggtgggcacctctatgcacctctctgaagtgtcgacccctcccggcag
GACAGTCTGCTCCAGCCAGCCACCTCATCCGCGTGGAAGGCAATAATCTCTCGCAGTATG
TGGATGACCCTGTCACCGGCAGGCAGAGCGTCGTGGTGCCCTATGAGCCACCACAG
gtaggccaggagccaggctgtgcccagggccctgcagtcagctgtacgggtcgggggagg
ggtcccctgaggcagcccctgtccctcctcagttggctgatctgcctgcctgtcctgtcg
gcatctgtccagggctccctgctctgtgataagtctgtgtcggcggctccttcctcaccc

 3.19 Intr +  75751  75860  110  0  2  104   64   211 0.999  20.55
atggggtgggttggtggatggatgaatgagtggacagatatacaaatggcaacaactata
gagcagggcatccccctgcctacgtggagccaggaccagacatggagctgggggctgcca
ccttagtggattggggctgcgtgctgatgctagcccctctccctgctcccccatgtgcag
GTGGGGACGGAATTCACCACCATCCTGTACAACTTCATGTGTAACAGCAGCTGTGTAGGG
GGCATGAACCGGCGGCCCATCCTCATCATCATCACCCTGGAGATGCGGGA
gtgagtcccgggcacacggggtggaggtgggacagggctgggcaggcacggccgggggag
aaggggagctgtcatggagacctgcaggccaaggctagcttggggaagagactttggggt
gtgctgctggaggaaggaaccgccccctggcctgcagggcctgcctgggcacaagctggg

 3.20 Intr +  76116  76190   75  0  0   83   90    61 0.978   5.58
ggagacctgcaggccaaggctagcttggggaagagactttggggtgtgctgctggaggaa
ggaaccgccccctggcctgcagggcctgcctgggcacaagctgggcctccggagggaggt
gggagtccccggcgaggtctcagggcagcctcacagctttgagcctctgactccctctag
CGGGAACACTCGCTGCCGGCACTGGGTGCTCTGTGGTGACCGAGGGCTCTCAAGGCCGGT
CCTGCAGGGTCCGAG
gtgggtggggaaggtgggcaggttgagggtgggcagggttgagctcacaattctggctgt
gcccacccgacagtgggcaggtgctgggccgccggtcctttgagggccgcatctgcgcct
gtcctggccgcgaccgaaaagctgatgaggaccactaccgggagcagcaggccctgaacg

 3.21 Intr +  76264  76406  143  1  2   39   77   338 0.999  28.98
cctcacagctttgagcctctgactccctctagcgggaacactcgctgccggcactgggtg
ctctgtggtgaccgagggctctcaaggccggtcctgcagggtccgaggtgggtggggaag
gtgggcaggttgagggtgggcagggttgagctcacaattctggctgtgcccacccgacag
TGGGCAGGTGCTGGGCCGCCGGTCCTTTGAGGGCCGCATCTGCGCCTGTCCTGGCCGCGA
CCGAAAAGCTGATGAGGACCACTACCGGGAGCAGCAGGCCCTGAACGAGAGCTCCGCCAA
GAACGGGGCCGCCAGCAAGCGTG
gtgagcggccggccaggggaactggacgcgtgtgggaggagaaggggacacattggcagg
acacaatgtgagcccgcgtcccagggacagggccagtccctgaacggccccccacgccca
gactcctccctgacggagcctgagagcagcccccatataagtcgcttgtcctgggccaag

 3.22 Intr +  76765  76853   89  2  2   87  109   134 0.998  16.25
agggcacctcagaggcctgggtggcaccgcaggtttgcccgtccctgtgggttgctcacc
accggacccacctggagaatcgattggccccaagggtggggcaggtctccctcctcccgg
aaggaggcctcaccctctggtcctgcctgctcaccccgcctgccctgcctggccttccag
CCTTCAAGCAGAGCCCCCCTGCCGTCCCCGCCCTTGGTGCCGGTGTGAAGAAGCGGCGGC
ATGGAGACGAGGACACGTACTACCTTCAG
gtgagtgtgtgctcctgcacggcagccgggagacctgcctcacctctgtcgtctgctgag
cccaggctgggccatggggagggactctggagaccatggtggagggggcgggaggagccc
agccctgtgtgagagggtccagagggcagaacctgcttgcaagagccagaccagcaggac

 3.23 Intr +  77963  78084  122  1  2   56   78   217 0.972  17.97
ggttagacctgcttcttgggaagaggaaagaagatcaggggatcctgagcctctggggtg
ctggggaacccccagaaaggacagatgctttgccaagcccaggtcctcctgaggctgcgg
ccacccccctcccgtgggggtctggggcacgtgggcagagatctgctcctctgtgctcag
GTGCGAGGCCGGGAGAACTTTGAGATCCTGATGAAGCTGAAAGAGAGCCTGGAGCTGATG
GAGTTGGTGCCGCAGCCACTGGTGGACTCCTATCGGCAGCAGCAGCAGCTCCTACAGAGG
CC
gtgagtcagccctagcccaccatcagtgtggggaaggaggacatggcttaaccccccagg
agaaggccaggaggaccagaaacccctccagaaggcatcatctgccagggacaggcagca
gggtccagagcagagcccaccccacatctcctcctccaggaagccttctagcacttgggg

 3.24 Intr +  78636  78784  149  0  2   32   92   204 0.983  16.27
cgcaggcccagtggccgtgcatggccatggttggggacagggaggctgggggaggatgaa
gccactctctgacatcagaggctccacccattcgcagcatgggggcatcacgggcatggg
tggtcggtgggcacgaggctgccttgcttcccacccatgcgagccgttgcttctgagcag
GAGTCACCTACAGCCCCCGTCCTACGGGCCGGTCCTCTCGCCCATGAACAAGGTGCACGG
GGGCATGAACAAGCTGCCCTCCGTCAACCAGCTGGTGGGCCAGCCTCCCCCGCACAGTTC
GGCAGCTACACCCAACCTGGGGCCCGTGG
gtgagtcccttgggcagtgcgggcccacgggcagggcggggaggcccactgggggcgcct
agctcaggacacaccacccagctcgggacccagggcaggtgtctctgtggctggctcctt
ccagcggttccaccctctgggcaggaggcgcagccacggatagccctctctgcccactcc

 3.25 Intr +  79563  79701  139  1  1   87   96   129 0.994  14.30
acagggccccaggtgttcagcccttgctcaagcctctagctggcaggggtgatgcccagc
gtcacatcgccaggccttgggatggctccctggtgtccagaggtgtctggagcctgggtg
gaggctgcacctggatgcccagcctggctgccctgatggccccacctgcctctcacccag
GCCCCGGGATGCTCAACAACCATGGCCACGCAGTGCCAGCCAACGGCGAGATGAGCAGCA
GCCACAGCGCCCAGTCCATGGTCTCGGGGTCCCACTGCACTCCGCCACCCCCCTACCACG
CCGACCCCAGCCTCGTCAG
gtgcgtgggctgccgagggcctgagcatgtgctgtcaccctgtctgttcacctctgtcct
tctggccatgtcagctgccctgccccaccctgtgtgctcaccactcgcaaccctggatca
gacaggcgggcgggggcagtcaggccaggagcatctgcagatgctggggaaatggtccac

 3.26 Intr +  80099  80192   94  2  1   94   82    43 0.992   5.43
acctgtccccagctgagcacgtcccctccctgagggatgccgtggccacctgtgggctgg
agccacccttcggagacagcggcagtctccgccccagccaggccactctcagagatgggg
gctcgcgcagccctgtgctcggaagctaatgctgcttcctttctcaaattctctctgcag
TTTTTTAACAGGATTGGGGTGTCCAAACTGCATCGAGTATTTCACCTCCCAAGGGTTACA
GAGCATTTACCACCTGCAGAACCTGACCATTGAG
gtaacgcccgggtggaccccgctctgcagaggcagtagctggaggggcccctgtccggag
ggcaaagagccttctcttccttgctctcgtggctgggaaacttggaaaccctttcccacg
ggcaagcagatgcgatgatttgactcttgagagcttaggcagatgcagccaggcacgtgg

 3.27 Intr +  80742  80864  123  2  0   25   56    77 0.521   0.16
atttacacagacaggaaaggggacctagggaaggcaagcacctggcccgaggccacacag
ctcttggcacccatggcagctgactgcaggcaccatgattaaacagccacggcttgtctt
tgggttagagactagtggagtacaaagcctgctggtagcctaggacggtgtgaaccacag
GGCACCGTCAGTCAAGGAAGAGCAAGCCCTCTGGTGGGAACCTGCCCCCCAGCCAGTGCC
GCGGCCCAGGTCCAAGGCCCGTCCCAGACCATCCCCAGCCTGGGGCTGCAGACAGAGATG
AGG
gtcagtgcgagctagggccagctgctcagcctaactgtccctcgtgcagagagtggccgc
gtctgtgtccactaaccgccctccccgcaacctgtccccagtgacccacgctgagccagc
tccaggtcacgttaacccttgcctcccctgagtgatgtgtgtgcttggtgtggtgcccag

 3.28 Term +  81383  81715  333  1  0   96   55   853 0.999  78.45
caggccccgcacaggccaggagtgactctggtgggctctccccctcccccgtctcctgcc
tactctggttgggggtgtaggggccagggtgtggtgtggccagacctccaggcccagggc
gaccccccctgctctccctgctccactgccccctgcccctaatgcgccggcctctcgcag
GACCTGGGGGCCCTGAAGATCCCCGAGCAGTACCGCATGACCATCTGGCGGGGCCTGCAG
GACCTGAAGCAGGGCCACGACTACAGCACCGCGCAGCAGCTGCTCCGCTCTAGCAACGCG
GCCACCATCTCCATCGGCGGCTCAGGGGAACTGCAGCGCCAGCGGGTCATGGAGGCCGTG
CACTTCCGCGTGCGCCACACCATCACCATCCCCAACCGCGGCGGCCCAGGCGGCGGCCCT
GACGAGTGGGCGGACTTCGGCTTCGACCTGCCCGACTGCAAGGCCCGCAAGCAGCCCATC
AAGGAGGAGTTCACGGAGGCCGAGATCCACTGA
gggcctcgcctggctgcagcctgcgccaccgcccagagacccaagctgcctcccctctcc
ttcctgtgtgtccaaaactgcctcaggaggcaggaccttcgggctgtgcccggggaaagg
caaggtccggcccatccccaggcacctcacaggccccaggaaaggcccagccaccgaagc

Predicted peptide sequence(s):


>TP73_1|GENSCAN_predicted_peptide_1|167_aa
MWPAGNRGEGRGTGVRGAAPGPGGGERLLSAKQGLPPTSPVEPRSRPAEDPAESLWGLLS
QPQPEFGPHVLPGVTQDANTPGRRPAPCSLPRPPPVGSGSGSRSVFGRSSRASAIGASRA
LDHVHQALARGPDMLGEFRAALSGGAAYGLMLMGPVIWLRTDVLCPW

>TP73_1|GENSCAN_predicted_peptide_2|97_aa
MSGMTHTEARLLPVPYNHQAPVWRVGTTQVDPEARRLWKRKLRVWLMYSDWWRKWSQEVI
AKITGNGALGDMKGPPWLALLPVDATAAGSWGPNRSR

>TP73_1|GENSCAN_predicted_peptide_3|1186_aa
MWLGGRDHGLFLACCVALGAFYTTLRISLLIPKAGMMMGPGDHMGTVLSLSLVPLGPGPH
WFFLHCHHLILNNRRSMATRYGLWGIHDSTAPSDPVENVPTWEYPLGVELPLSFLFLMPS
TPRCLRSQSSAQGPARGSHRLLSAPACLGKDKNDRFQAMACTPAGRGQSELPSEAGVGKM
AQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSV
MSAVACGSVVPPCPAAQGPAESQAESPGPELGSPGPSPLGHNTWNRPFVLSPACCCGASP
ARSTLPGGHDRDPSPRAAQIHASSHGTPVPWRVQTPRRLPCCTSVTPHGTSPREADSWDH
GYLCHTGNSAMGRGQRADRQSPSAPKLCWHWDVEAQRSGDGGLWSRGLPRQCDQDPHCLQ
ELLVSTRLLLPGALGVSNGQLCHHCFFLHQGLLWPAFTFSRARPCLDASPGPCAWLCVSE
TTFDPKPLHACWLPSWTAFSTFGLLLQCPLITEGHRRCAESLFRLINGWVDPQKPWHREA
DGGEGEAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIP
SNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIR
AMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSV
VVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGNTRCRHWVLCGDRG
LSRPVLQGPSGQVLGRRSFEGRICACPGRDRKADEDHYREQQALNESSAKNGAASKRAFK
QSPPAVPALGAGVKKRRHGDEDTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQ
QQQLLQRPSHLQPPSYGPVLSPMNKVHGGMNKLPSVNQLVGQPPPHSSAATPNLGPVGPG
MLNNHGHAVPANGEMSSSHSAQSMVSGSHCTPPPPYHADPSLVSFLTGLGCPNCIEYFTS
QGLQSIYHLQNLTIEGTVSQGRASPLVGTCPPASAAAQVQGPSQTIPSLGLQTEMRDLGA
LKIPEQYRMTIWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRV
RHTITIPNRGGPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH