GENSCAN 1.0	Date run: 14-Jan-104	Time: 15:20:45

Sequence TNR_1 : 86396 bp : 43.83% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1282   1780  499  0  1   74   80   655 0.802  58.53
acgccccccccttgaaaatctctggctgcctactcctgagctttgtaggcttgtgcagag
ccatggtgccaaggcataggtctcagaggttgtctctttccttggtttccgttgcagatt
cccacaactccatgctgtgtgctgcaggctggtcctgaacccagatctctggctgagagg
ATGGGGGCAGATGGGGAAACAGTGGTTCTGAAGAACATGCTCATTGGCATCAACCTGATC
CTTCTGGGCTCCATGATCAAGCCTTCAGAGTGTCAGCTGGAGGTCACCACAGAAAGGGTC
CAGAGACAGTCAGTGGAGGAGGAGGGAGGCATTGCCAACTACAACACATCCAGCAAAGAG
CAGCCTGTGGTCTTCAACCACGTGTACAACATTAACGTGCCCTTGGACAACCTCTGCTCC
TCAGGGCTAGAGGCCTCTGCTGAGCAGGAGGTGAGTGCAGAAGACGAGACTCTGGCAGAG
TACATGGGCCAGACCTCAGACCACGAGAGCCAGGTCACCTTTACACACAGGATCAACTTC
CCCAAAAAGGCCTGTCCATGTGCCAGTTCAGCCCAGGTGCTGCAGGAGCTGCTGAGCCGG
ATCGAGATGCTGGAGAGGGAGGTGTCGGTGCTGCGAGACCAGTGCAACGCCAACTGCTGC
CAAGAAAGTGCTGCCACAG
gtagagtccgggagctcgcagcgtggtctcaggaggggaaggagagggctgagcagagag
ggagagtgaacaagaaggaccaatgcacttccagcgaaaacgcactcccagcaaaacccc
ggcatctcttcacacggtcaaaggaaaaaagtgtcctagtctgtagctgccggttaatat

 1.02 Intr +   4380   4856  477  1  0   99   96   496 0.993  44.52
cagcccatgctaggtgaaaatatttattaaattgaatatgtaccaaactacgttgagctt
cactctcagcaacagaaatctggtcagagaatgagtagagaggcctttgcccatccttcc
ccagcaccattgacaggagaggccactgctgctctttgaccttctccttgaccattccag
GACAACTGGACTATATCCCTCACTGCAGTGGCCACGGCAACTTTAGCTTTGAGTCCTGTG
GCTGCATCTGCAACGAAGGCTGGTTTGGCAAGAATTGCTCGGAGCCCTACTGCCCGCTGG
GTTGCTCCAGCCGGGGGGTGTGTGTGGATGGCCAGTGCATCTGTGACAGCGAGTACAGCG
GGGATGACTGTTCCGAACTCCGGTGCCCAACAGACTGCAGCTCCCGGGGGCTCTGCGTGG
ACGGGGAGTGTGTCTGTGAAGAGCCCTACACTGGCGAGGACTGCAGGGAACTGAGGTGCC
CTGGGGACTGTTCGGGGAAGGGGAGATGTGCCAACGGTACCTGTTTATGCGAGGAGGGCT
ACGTTGGTGAGGACTGCGGCCAGCGGCAGTGTCTGAATGCCTGCAGTGGGCGAGGACAAT
GTGAGGAGGGGCTCTGCGTCTGTGAAGAGGGCTACCAGGGCCCTGACTGCTCAGCAG
gtaggcaggggaactctctggggtgtttggcaagggtggtccagcaaactagctggatgc
ctccagttagcttgggaagaaagatgagtgagaaagtgaagtttaggcaaaataattctc
aattgagttgtactcatttgctttccaagagagctgagttcttgagtcttgatgaggcag

 1.03 Intr +  11189  11452  264  0  0   66   67   364 0.964  29.58
actaagcaccaaaaagacaagagcctgctcacaaaggaagttacaaatcacttaaagcca
ttgagcccagcaggacatatagacatggcatggggggtgagatgtgaggaagaaagttga
gtccaggatggggaaggcaatcctctgagctcatgctatctgtgtattgcctcccggtag
TTGCCCCTCCAGAGGACTTGCGAGTGGCTGGTATCAGCGACAGGTCCATTGAGCTGGAAT
GGGACGGGCCGATGGCAGTGACGGAATATGTGATCTCTTACCAGCCGACGGCCCTGGGGG
GCCTCCAGCTCCAGCAGCGGGTGCCTGGAGATTGGAGTGGTGTCACCATCACGGAGCTGG
AGCCAGGTCTCACCTACAACATCAGCGTCTACGCTGTCATTAGCAACATCCTCAGCCTTC
CCATCACTGCCAAGGTGGCCACCC
gtacgtaccatttccccgtcctgcttcatttttcttttctcctacatgagatcatgggca
ttcatgatagtagcgtcttttcttagttcttcagggatgcctggaatagttattgccctt
gaggggaagggctagagatgtgacccatttagaaagggtacatcattaaaaaggcacttt

 1.04 Intr +  14101  14216  116  2  2   88   87    79 0.962   7.97
ccacatggggtgggttgattctgcacctgggactcactgtgtctggagcaagattgggat
tgtccaccagacaccaccacgcccatggcgtggagggagttcaccaagacaaagcaccag
gcaatgctgtctgtcccaagggttagccatgacattgtcacctacattgctgtgttccag
ATCTCTCCACTCCTCAAGGGCTACAATTTAAGACGATCACAGAGACCACCGTGGAGGTGC
AGTGGGAGCCCTTCTCATTTTCCTTCGATGGGTGGGAAATCAGCTTCATTCCAAAG
gtaacactcacctgttacactgccaaacagacttatttggaatatttgtacctttagctt
ggaatcaggggcagcaaggaaagtgctacccaatatctctctccatgccattaaagacac
aaaatggcatgttgtgggtgtctgggatatagaacatttctgtgacaaatatgtggtaac

 1.05 Intr +  16558  16708  151  0  1   80  109   141 0.988  15.14
gagtctatggggagttatttctggccccagatactcagctgtcagcatggaggaaagaga
catcgcccccattttaaattcacaatccacaattagtattccacacctttatctttctct
catcagatttctctcccagtgacttttctcttttgctctctgcttctccccactgtccag
AACAATGAAGGGGGAGTGATTGCTCAGGTCCCCAGCGATGTTACGTCCTTTAACCAGACA
GGACTAAAGCCTGGGGAGGAATACATTGTCAATGTGGTGGCTCTGAAAGAACAGGCCCGC
AGCCCCCCTACCTCGGCCAGCGTCTCCACAG
gtgagtgcctccaacccttctccctagagctgcctactaggtcacttggaaaagaaccac
agaattgcccaaggagtggagagacaacagaggtgctagaatttctcctagagctgggac
aattctggtacctggcaatggagctactctaccagatgcttagctcatcatcttccctat

 1.06 Intr +  21608  21964  357  0  0   56  110   325 0.495  26.73
gcccagactgggaagtgccatcacctggaaactacagcctggtaaaagagcagttagacc
aaaattcaggggaatcaaggcaaactacatgtcctcaggaaagatattcatcttactgtg
tctcattttcctcatctgtaaaatgcagtaacaatacccatcctctctctgactcaccag
ACTTCCATAAGGAGGAAAAGAGAGAGCTGACACCCAAGGCTTATTTCTCATTCAAACTTT
TTGTTCTGTTTGATCCTTCTCACTCAGTCATTGACGGCCCCACGCAGATCCTGGTTCGCG
ATGTCTCGGACACTGTGGCTTTTGTGGAGTGGATTCCCCCTCGAGCCAAAGTCGATTTCA
TTCTTTTGAAATATGGCCTGGTGGGCGGGGAAGGTGGGAGGACCACCTTCCGGCTGCAGC
CTCCCCTGAGCCAATACTCAGTGCAGGCCCTGCGGCCTGGCTCCCGATACGAGGTGTCAG
TCAGTGCCGTCCGAGGGACCAACGAGAGCGATTCTGCCACCACTCAGTTCACAACAG
gtaaggctgcggtgggggagagacgcacaaggagggaaagaggggtggagccaaccggtg
gtgtcatcacagcaagaggagtattaggaatgaggcaaggtgtgtcagagcattggcctt
gtcatagacaccgcgagaaggaagcaagaggtttccagcatacaggaaaagcagcgctcc

 1.07 Intr +  28259  28444  186  0  0   54  109   184 0.847  16.76
gcccaaggaatttgtcacagcagaccaaaaagctaagggtagccacagtgttcattcaaa
tgtgagccagagggtcagggggtgtgggctgtcaccaccaatcttttcagagttcaagat
gcaccacaaatgtacattacattatcatgtgcgatgttggtgatgtctgtctatttttag
AGATCGATGCCCCCAAGAACTTGCGAGTTGGTTCTCGCACAGCAACCAGCCTTGACCTCG
AGTGGGATAACAGTGAAGCCGAAGTTCAGGAGTACAAGGTTGTGTACAGCACCCTGGCGG
GTGAGCAATATCATGAGGTACTGGTCCCCAGGGGCATTGGTCCAACCACCAGGGCCACCC
TGACAG
gtgagtaagacctatctcttggggttatgctggttgctgagtctataccctcacagctgt
ctccccaacctacacatcttacaaacccatggccaattcctattgatctcatctcttaag
tgcctagcacatatgtctagtactatccattgtactgccatcacctgttctaagctacta

 1.08 Intr +  40699  40788   90  2  0   54  105    95 0.776   7.77
ttgacttgggattcctaaatagtgaaattgggatttcttaatagttcaaattaggagagg
attcaaggaggactaaacacaagatatgaataggagtctaagatcattttcttcccactt
tcagccttcctagccctgccccatacacagaataatgtttgtttctccatccactgatag
ATCTGGTACCTGGCACTGAGTATGGAGTTGGAATATCTGCCGTCATGAACTCACAGCAAA
GCGTGCCAGCCACCATGAATGCCAGGACTG
gtgagtaggaggactgctgaggaagaagaccaggttagcctataagcctaaggagtcatg
gaggctcgtcccagcaaaaattaatcagaaagcaatgtcttccagtgaacagggctctgg
tgacaactgtcagcctagaaacaacatccaccctatgcctaatccttgatctctgacagg

 1.09 Intr +  41858  42121  264  0  0   57   81   215 0.929  15.18
gcccctggccatcattcagagggaaggtacttagcaaaatattagataagtgtcagcaat
gacaagctagtgctcatagtcagcaggcctgctgatagcttggaaacacacaaagcaggc
caataaatactgccctccaggggaacacatgtaaaataggccatttatgtcaatccacag
AACTTGACAGTCCCCGAGACCTCATGGTGACAGCCTCCTCGGAGACCTCCATCTCCCTCA
TCTGGACCAAGGCCAGTGGCCCCATTGACCACTACCGAATTACCTTTACCCCATCCTCTG
GGATTGCCTCAGAAGTCACCGTACCCAAGGACAGGACCTCATACACACTAACAGATCTAG
AGCCTGGGGCAGAGTACATCATTTCCGTCACTGCTGAGAGGGGTCGGCAGCAGAGCTTGG
AGTCCACTGTGGATGCTTTCACAG
gtaccagagcagcagaaatcccagccaggttcagggatcagtggatctcagtgtgagaaa
ttcattcaggcaagtcactcttccaatgttccatttcctttggagaaaagagaggtgggt
agaaaaggatagagtaaaaactaataagtgcatcaagagggaagggttggaagtaaagag

 1.10 Intr +  42717  42986  270  1  0  106   94   196 0.845  19.51
ggattggaaaaagtggagtgaacagcactggagggtgaggaggtggaatctcttggttag
tgggtgaaggtgtggcccttattagcaaggagagcaggtccctttagccaagaagttctt
ctagcccagtgacccatctcctcacgtgtttcaggaccatccatctcctttgctttgcag
GCTTCCGTCCCATCTCTCATCTGCACTTTTCTCATGTGACCTCCTCCAGTGTGAACATCA
CTTGGAGTGATCCATCTCCCCCAGCAGACAGACTCATTCTTAACTACAGCCCCAGGGATG
AGGAGGAAGAGATGATGGAGGTCTCCCTGGATGCCACCAAGAGGCATGCTGTCCTGATGG
GCCTGCAACCAGCCACAGAGTATATTGTGAACCTTGTGGCTGTCCATGGCACAGTGACCT
CTGAGCCCATTGTGGGCTCCATCACCACAG
gtgaggctggaggacttggcagcaggtgatgaaaggggttttcacagtagcctttgacaa
atcaatgaaattttaaaagagaaagacccaaggagtaggggatttcctctatggctagag
aaagtctgtgacctgttctgaaacagctacttcctccagtgctgcagaagatgcattaga

 1.11 Intr +  44169  44288  120  1  0   63   87   103 0.995   8.17
cctacaaggtttcaagtgaaacatcagcgtgaccatggttttaagataccctattacatg
gaaagatcttgtctgcctttgggacaacattggcttttggtcaacataaaaccagggatg
agaatttctttttcacactgtgctttctgtctttttcccacaatcactgggtccttgtag
GAATTGATCCCCCAAAAGACATCACAATTAGCAATGTGACCAAGGACTCAGTGATGGTCT
CCTGGAGCCCTCCTGTTGCATCTTTCGATTACTACCGAGTATCATATCGACCCACCCAAG

gtaacaaagtgatttgatttctcaaagatactaggatttgggtgaagattatgggagaac
tagcatatcccgcagaacatccactcctgcctgcgtttttcctcttctctgtggcatgct
gcatcagaatgagagtgggctggtgagcagccaagaaaccccacactcaccaatgcctct

 1.12 Intr +  45187  45333  147  2  0   96   75   137 0.970  13.41
gagaccagtgtgcaaagcctcttcacactccaacattcccagcccatgaaccatgtatca
tccctccccactgagtgcggagtcccacacccatctgtgctttattgacatagactgtac
catgggctgcttggatgaaagggctgctgaattttaactgtagattcttctcttctccag
TGGGACGACTAGACAGCTCAGTGGTGCCCAACACTGTGACAGAATTCACCATCACCAGAC
TGAACCCAGCTACCGAATACGAAATCAGCCTCAACAGCGTGCGGGGCAGGGAGGAAAGCG
AGCGCATCTGTACTCTTGTGCACACAG
gtgggaatgtctccctgctgtgtcaagtcagaaccctggctgaagatctgggtgaagttg
ttcgggcttgtagaaaggttctggaggctaaggctccatttcggggtgctcctccaactc
actgtgtcttgcagggcaatttgcaatttctctcccccaatattcctccctaatactaaa

 1.13 Intr +  48265  48384  120  2  0   79   94   154 0.977  15.57
ggagaaatggaagaggctgatggaaccagaagaggagaaagggaagaggtttctgctcac
ttctttgttttgtagagtgcagcagcagtcttgcaccatgagtggaacttctgagatcat
tccctgcatttctatcctgcagctcctcttatctgtaactgataatctattctgtttcag
CCATGGACAACCCTGTGGATCTGATTGCTACCAATATCACTCCAACAGAAGCCCTGCTGC
AGTGGAAGGCACCAGTGGGTGAGGTGGAGAACTACGTCATTGTTCTTACACACTTTGCAG

gtgggtgtctgcaggcctgcagatcaggcaggtgggaatggtgggaattggagctgcaga
ccagtatgatgtgaataaacaaaacattttttcaatctgaaggacagattagaaaagttc
ctacttcaggtatactatgaagccctcaagatatccccaaactctatgctgggcatcgtg

 1.14 Intr +  51534  51677  144  1  0    3   80   163 0.934   7.25
atgatatgagatgagaggggaatccttgcaaagagtaagatactaagctagataacctat
gaaagatttttttccaaaattctctagtagtaaatccatgtgaaatacctttggatttgg
tagatctttcctaaactgagtagccttattcaacccttattcatattcatttgagttcag
TCGCTGGAGAGACCATCCTTGTTGACGGAGTCAGTGAGGAATTTCGGCTTGTTGACCTGC
TTCCTAGCACCCACTATACTGCCACCATGTATGCCACCAATGGACCTCTCACCAGTGGCA
CCATCAGCACCAACTTTTCTACTC
gtgagtacatggtcacctacatacccgtatccctggggacttttgtggaaatgatcagct
ttcttgtggtggactagattatcacttacaggctttggacagggcagctatgagctgttc
ttatttggactgactacagcccaaattcagtgaaactaagctgcaacttttggccagcag

 1.15 Intr +  52363  52493  131  2  2   90  100    71 0.996   8.91
actgaatgattatcatctgacccaggagcaccctttatgctcctttccaagccagagcag
gggtcagcatgtgagcaatcctgagaccaaagaggtgggcaacagatacccatacctgaa
atcaagcagggggaggagctggagaggcaggcatgccctggcactttctcctctttgcag
TCCTGGACCCTCCGGCAAACCTGACAGCCAGTGAAGTCACCAGACAAAGTGCCCTGATCT
CCTGGCAGCCTCCCAGGGCAGAGATTGAAAATTATGTCTTGACCTACAAATCCACCGATG
GAAGCCGCAAG
gtgagattttgctggaaagggaaaagaccatttcttccaagtgaggccatgtggaaactg
actagtggagtgaccacaggacattggagggagggggaaggaagcaatccacaaggattg
ctcatcagcttcccatcaaggatacccagcctgctgttgatgagagagccctagtctgca

 1.16 Intr +  53473  53605  133  0  1   73   94   245 0.996  23.82
catgggagctctcctctctgcttattggtgcagtaatccttattgtgggatggagaggat
gacaatggccattgcaatactgacctagctgcccatgggatttggacttcccttccctac
tttcccaaattgcaagccagttgctcccttccaccacccttcctttggctcattatacag
GAGCTGATTGTGGATGCAGAAGACACCTGGATTCGACTGGAGGGCCTGTTGGAGAACACA
GACTACACGGTGCTCCTGCAGGCAGCACAGGACACCACGTGGAGCAGCATCACCTCCACC
GCTTTCACCACAG
gtgagggagcatggccactttgatgccttcttctccacttcctgatgtttggctcatcag
cagcctctgctgagacttgctctgggagcagtttatcaaaaaagctcagttgcctcctcc
ttcttttcccctgtccaagcccctaccaggaaacctctcactaacaaggtaaccgcagga

 1.17 Intr +  70317  70468  152  1  2   79   87    82 0.839   7.08
gtggaagggaaatccaagatgatgccaagtccccacacccacaccttgagctccgttgag
gatttcttacagctgttgatgatgtaccaggaggcctgctaagaccttctatgatccaag
gagctcttgtgcactgtgagagaaagaatcctttctggacattgtctattttccttgcag
GAGGCCGGGTGTTCCCTCATCCCCAAGACTGTGCCCAGCATTTGATGAATGGAGACACTT
TGAGTGGGGTTTACCCCATCTTCCTCAATGGGGAGCTGAGCCAGAAATTACAAGTGTACT
GTGATATGACCACCGACGGGGGCGGCTGGATT
gtaagtacaatctgtgctctccttgcacagaagcgtcctcagtgttctagtctacctagc
tcagcacctgccaagccaacttcaccatcctcctggccatccttttatcaccccccacat
gtccatcttggggctcctcattgccctcaaggcccatgttcagagtccaatcatatatct

 1.18 Intr +  72189  72285   97  2  1  111   38   108 0.998   7.68
aaaaactgctgtgtaaatactgagctctgctctgaaatgttccttctttggacatctttg
tcattgcagatataaaacccagttatatcaattttacttatcacagtttattttccttag
catctctttgggttttgtttttttgtttgtttgttttttgtttttttatttccttcatag
GTATTCCAGAGGCGGCAGAATGGCCAAACTGATTTTTTCCGGAAATGGGCTGATTACCGT
GTTGGCTTCGGGAACGTGGAGGATGAGTTCTGGCTGG
gtaaagcctccttattgctttccattgatgtgcttctctggctttttgtccatctctctc
ctttttgtgtccatctgagattatcagaaaccctgtgtttgttgagaagctaacagctcc
tgaattgctttcagaacctcttgctctgtttagcttcactattgatctgtttttatctta

 1.19 Intr +  77761  77922  162  2  0  135   49   298 0.668  30.55
ggaagaaattcagtctggcagggtccatttgataacaacctgtgaagcaccaagagcaaa
agcaatctggagtcccctcctcttccctgtaacatgttttgaagccacagacgcatttcc
ctcccattttccaaagctgctgggggccagtctcagtgcattttctgctcttctccacag
GGCTGGACAATATACACAGGATCACATCCCAGGGCCGCTATGAGCTGCGCGTGGACATGC
GGGATGGCCAAGAGGCCGCCTTCGCCTCCTACGACAGGTTCTCTGTCGAGGACAGCAGAA
ACCTGTACAAACTCCGCATAGGAAGCTACAACGGCACTGCGG
gtacctatggctcctgagcagaccccaaggacagtgggcatgggacaagagcccccagat
tctaggcgtaagctgcctcaggaagcagcagcacccacagagttccagcattcgctgctg
gccagggagaagaagggccatgccactgggaaccactggcactggtcccagctctccctg

 1.20 Intr +  83477  83640  164  0  2   94  115   133 0.553  16.29
gtggttggccccaggggtaaggtggagtaagagttcagcacagccactctgagaaactgg
gtggaaatgaaaaggttccataagtggaagccaggtttgctggaagtgggtcaagtgtcc
agaaaatcctgataaagcagtgacaaatgggacagcctaatgaatgtatcttttttgcag
GGGACTCCCTCAGCTATCATCAAGGACGCCCTTTCTCCACAGAGGATAGAGACAATGATG
TTGCAGTGACTAACTGTGCCATGTCGTACAAGGGAGCATGGTGGTATAAGAACTGCCACC
GGACCAACCTCAATGGGAAGTACGGGGAGTCCAGGCACAGTCAG
gtaagcgatgctccacctctgctatgaatgagccagagctgtggaatccgtgctccctta
gctttatattttaaaagcacatgtgagtccttcatttccctttaaaaagaaatattttga
gtcttgagaaaaataatgcagacaatgggataagatcaggacagagtagaagccagagga

 1.21 Term +  84520  84639  120  0  0  102   53    83 0.936   4.67
aaagctagaaagagactctgcccctttcactttattgggaactcggccttgaagcttcat
gttagctgaaaatagctaaccccacattgtggattccctgttcccataattacccctttt
ttgaagtggggcgttccatggtgggggatgacctgacatgcttatctttctcacgcccag
GGCATCAACTGGTACCATTGGAAAGGCCATGAGTTCTCCATCCCCTTTGTGGAAATGAAG
ATGCGCCCCTACAACCACCGTCTCATGGCAGGGAGAAAACGGCAGTCCTTACAGTTCTGA

gcagtgggcggctgcaagccaaccaatattttctgtcatttgtttgtattttataatatg
aaacaaggggggagggtaatagcaatgtgttttgcaacatattaagagtatgtgaaggaa
gcagggatgtcgcaggaatccgctggctaacatctgctcttggtttctgctgccctggag

Predicted peptide sequence(s):


>TNR_1|GENSCAN_predicted_peptide_1|1387_aa
MGADGETVVLKNMLIGINLILLGSMIKPSECQLEVTTERVQRQSVEEEGGIANYNTSSKE
QPVVFNHVYNINVPLDNLCSSGLEASAEQEVSAEDETLAEYMGQTSDHESQVTFTHRINF
PKKACPCASSAQVLQELLSRIEMLEREVSVLRDQCNANCCQESAATGQLDYIPHCSGHGN
FSFESCGCICNEGWFGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSELRCPTDCS
SRGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGRCANGTCLCEEGYVGEDCGQRQCLNA
CSGRGQCEEGLCVCEEGYQGPDCSAVAPPEDLRVAGISDRSIELEWDGPMAVTEYVISYQ
PTALGGLQLQQRVPGDWSGVTITELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG
LQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEY
IVNVVALKEQARSPPTSASVSTDFHKEEKRELTPKAYFSFKLFVLFDPSHSVIDGPTQIL
VRDVSDTVAFVEWIPPRAKVDFILLKYGLVGGEGGRTTFRLQPPLSQYSVQALRPGSRYE
VSVSAVRGTNESDSATTQFTTEIDAPKNLRVGSRTATSLDLEWDNSEAEVQEYKVVYSTL
AGEQYHEVLVPRGIGPTTRATLTDLVPGTEYGVGISAVMNSQQSVPATMNARTELDSPRD
LMVTASSETSISLIWTKASGPIDHYRITFTPSSGIASEVTVPKDRTSYTLTDLEPGAEYI
ISVTAERGRQQSLESTVDAFTGFRPISHLHFSHVTSSSVNITWSDPSPPADRLILNYSPR
DEEEEMMEVSLDATKRHAVLMGLQPATEYIVNLVAVHGTVTSEPIVGSITTGIDPPKDIT
ISNVTKDSVMVSWSPPVASFDYYRVSYRPTQVGRLDSSVVPNTVTEFTITRLNPATEYEI
SLNSVRGREESERICTLVHTAMDNPVDLIATNITPTEALLQWKAPVGEVENYVIVLTHFA
VAGETILVDGVSEEFRLVDLLPSTHYTATMYATNGPLTSGTISTNFSTLLDPPANLTASE
VTRQSALISWQPPRAEIENYVLTYKSTDGSRKELIVDAEDTWIRLEGLLENTDYTVLLQA
AQDTTWSSITSTAFTTGGRVFPHPQDCAQHLMNGDTLSGVYPIFLNGELSQKLQVYCDMT
TDGGGWIVFQRRQNGQTDFFRKWADYRVGFGNVEDEFWLGLDNIHRITSQGRYELRVDMR
DGQEAAFASYDRFSVEDSRNLYKLRIGSYNGTAGDSLSYHQGRPFSTEDRDNDVAVTNCA
MSYKGAWWYKNCHRTNLNGKYGESRHSQGINWYHWKGHEFSIPFVEMKMRPYNHRLMAGR
KRQSLQF