GENSCAN 1.0	Date run: 14-Jan-104	Time: 18:12:14

Sequence TNFRSF1B_1 : 44616 bp : 55.34% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1290   1367   78  2  0   92   94   196 0.860  19.61
aggcgtgtccaaggccggctggccccgccccgccccgccgcctggcctctggcccgctgg
ggcgcgggctttcgctttcagtcgagggctagcgagcgcagcggagcctggagagaaggc
gctgggctgcgagggcgcgagggcgcgagggcagggggcaaccggaccccgcccgcaccc
ATGGCGCCCGTCGCCGTCTGGGCCGCGCTGGCCGTCGGACTGGAGCTCTGGGCTGCGGCG
CACGCCTTGCCCGCCCAG
gtgggtgactcgcgcggcccacgggggacagccgccccgcatgtccacccggctggtgcg
cagccttcgggtgcccgggccgcgctctcccggggcgctgtcacgggctgggaggctggg
agtcccagtcgccgccccccatccgcatcagacacgcgcgcctctggggacccgctgggg

 1.02 Intr +   1863   1898   36  2  0   59   89    46 0.478   0.74
tgggcagacccccgctagacccgggacccctcttccctcaccccggcgactgccgcgaca
gcccttccctcccacgcggtggagaaggggctgtgccggggcgctgccccactgcccacg
ccgggcaccctcttcaaaagacttccttttcctctgggcgacggttttccgatttcttag
AAATACCAGGGTCCTGTGTCTGAAGAGCAGGACCAG
gtgtgtgtcaggtccactgagggcacagctggagggcgagctgcctgtctgcttcctccg
atgcgtccgggggctactgcagagtctgttttctgcggcctctggggacagggcaagcga
gggaggtctgggctggtaatcgagcaaggcaaatgaagtctccgggggccgcaggaaaat

 1.03 Term +   3027   3047   21  2  0   85   54    -5 0.291  -5.61
tgcagtcctggagtagctggaggaggttccctcccacttccttcccttcctgaccagctc
ctgcggcagctcatattccctcctccctcatccctgctccccacgaccccacccggacta
ttgccgcagccttgtagctggtctcccggccctgccccctctcccgctgatccttggcag
AGAGACCCTTCTCAAGCATGA
ggcacctctctgtttgcctggggagcctcctgtggctcccaatggttgaggcagaaactc
ccctggagatcccaggccagagtaaggtacctgaactcttcctcgcgcctccctgcacat
gtgctcccccgcctctgtagaactgatgatggtcatcgtgtgtgtcattgtgcaaaaagc

 2.04 PlyA -   3943   3938    6                               1.05
 2.03 Term -   6107   6080   28  1  1   87   42     7 0.297  -6.17
 2.02 Intr -   8491   8024  468  0  0   13   90   368 0.646  22.30
 2.01 Init -  12376  12252  125  1  2   62   72    53 0.681   0.71
 2.00 Prom -  12625  12586   40                              -0.71

 3.04 PlyA -  14620  14615    6                              -3.94
 3.03 Term -  15904  15803  102  1  0  120   39    82 0.300   5.08
 3.02 Intr -  19466  19429   38  0  2   73   55    47 0.238  -1.63
 3.01 Init -  20673  20556  118  0  1   97   94   101 0.989  11.92
 3.00 Prom -  21671  21632   40                              -6.80

 4.01 Init +  22257  22313   57  2  0   70   76    50 0.934   3.27
tgtaccagggtgggtcccaccttgaggctgtggagcattcattatcagccaacacccaca
gcagctgggggagcggtgccctgctggcagcaggggtctgagtggggtgcaacagcaccc
accaattcgagcagcagaaacgcttagaacagtgcctggtacctaggcagtgcttcaaaa
ATGGCAACGATTGTCATGGTCATAACCAACATTCAGCTGATGAGTGCCGGCTCTACG
gtgggtcccatgtgagagattgagggtctagagatgacaaggctgccacctctgctgtct
gcatcacatgagtgtgtgtgtacacatgtgtgtgcatacatacccacagggggtggaagg
acaagcaagtaaccattccagaacaatgagatgactgttagaggggtcataacccacgtt

 4.02 Intr +  22994  23093  100  1  1  129   76    83 0.983  11.38
aaaagaaggcacgagctctccttcctgtaccctgctccagggggagaaacctccccagcc
atcatcagtgcagactggcagggggagggccaaacatttgcagggcggggacctgggcat
caggcatggcagaacccaggggcggccctgttgatggcagtcttcccttcttccttccag
GTGGCATTTACACCCTACGCCCCGGAGCCCGGGAGCACATGCCGGCTCAGAGAATACTAT
GACCAGACAGCTCAGATGTGCTGCAGCAAATGCTCGCCGG
gtgagggcagccacgggggcactcggggcccatgccctggaggagcgtgtgtgtacaggg
gctggggcgcaagagcatagcccttgattcttactgaactcctagttctatgcactggcc
catgctccctgctgcttctgggcctgtgaacatgctgttccctcttcctggcacacttcc

 4.03 Intr +  25155  25283  129  1  0  102  105   100 0.995  14.27
cagaaatgacgtgatagctggtacaatactagatgggagatgattctgaggaattggaac
tccacagaatagccttcccagctgggctttagaactctggactttgtggggacagtggat
gagcccagggtcctggcagaaggctcgcccagctgagacctctggcccttgtttcctcag
GCCAACATGCAAAAGTCTTCTGTACCAAGACCTCGGACACCGTGTGTGACTCCTGTGAGG
ACAGCACATACACCCAGCTCTGGAACTGGGTTCCCGAGTGCTTGAGCTGTGGCTCCCGCT
GTAGCTCTG
gtgagtaggttcagagaaaaagggggcccttacacccctgcctccaacttcccccggcaa
ctccagcctctttggcttccagctgtctggagttaccccaggctggttgttggaagtggc
acaggtgcagctgtttacccctaccactggcattttcctcctctgtctcaccaaagcctc

 4.04 Intr +  25535  25810  276  0  0 -108   -9   349 0.233   3.63
ttggcttccagctgtctggagttaccccaggctggttgttggaagtggcacaggtgcagc
tgtttacccctaccactggcattttcctcctctgtctcaccaaagcctcttcacagcccc
acggggcaggcggtgggagaactgtgcccacgtgagggttgaggaggtggtgcgtgggag
AGTGGTGCGCATGCTCGTGCTGCGAGGAGCAGGACTGCGGGGAGGAGCGAAACTGCTGGG
AAGAGCGGGACTGCGGGGAAGAGCGGGACTTCGGGGAGGAGCGGCACTGCGGGGAGGAGC
AGGACTGCAGGGAGGAGCGGGACTGTGGGGAGGAGCGGGACTTCGGGGAGGAGCGGGACT
GCGGGGGACGAGCGCGACTGCGGGGGACGAGCAGGACTGCGGAGAGTAGCGGGACTGCGG
AGAGTAGCGGGACTGCGGAGAGTAGCAGGACTGCCG
gtcctgcccctggactctggccggtgttgtgtgtgccccatgctgaggcggtccgccagc
ctcctggagatccgctgtctgagagtgctgggctgtctgggagggcagcgtgggtgtggc
ggaggcaggcgtgaccgtttgccgccctctcgctgctctagaccaggtggaaactcaagc

 4.05 Intr +  25972  26121  150  2  0  109   96   194 0.993  22.95
gagagtagcaggactgccggtcctgcccctggactctggccggtgttgtgtgtgccccat
gctgaggcggtccgccagcctcctggagatccgctgtctgagagtgctgggctgtctggg
agggcagcgtgggtgtggcggaggcaggcgtgaccgtttgccgccctctcgctgctctag
ACCAGGTGGAAACTCAAGCCTGCACTCGGGAACAGAACCGCATCTGCACCTGCAGGCCCG
GCTGGTACTGCGCGCTGAGCAAGCAGGAGGGGTGCCGGCTGTGCGCGCCGCTGCGCAAGT
GCCGCCCGGGCTTCGGCGTGGCCAGACCAG
gtacggggtggggctcaggtccttggggacgcccatgggcctctcctttgtagacatcct
tgcagtgtcacgggcatcaacccattaattagtccagcagggagcactgttagtggtggc
caggtgcctgctacccatccgtctgtccacctgtccaccgttcattcttcctgccagcac

 4.06 Intr +  26629  26722   94  2  1   21   76   112 0.999   2.82
tgtgtgtgcatgtgtgtacaggcatctgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtaag
gggtggaggtgcagacagagctccttgggcccctcagacctctcctagggctctagtgcc
aaggcccagctgtcccgcagagtgtctgagtggttgacaagttcggattgttccctgaag
GAACTGAAACATCAGACGTGGTGTGCAAGCCCTGTGCCCCGGGGACGTTCTCCAACACGA
CTTCATCCACGGATATTTGCAGGCCCCACCAGAT
gtgagtagctgagtcctttggttctggaggagcagggaggggctgtccctgggtgactgt
gggtccaggacacagagcagctcaccaaccaccattgtccagactgctttatctgagggt
ggctcccaggataaatggcatggtgggcaggaccttgccctggaaggcaggactgggtgg

 4.07 Intr +  27061  27296  236  1  2  123  111   144 0.999  18.06
cctggaaggcaggactgggtgggtgcatggggaggtgggggagggctaggagggggtggt
cctcagagagggcacacatcgtcactctcctatcctgcctgctggggcccgtgaatgagc
ccagccaccccagccactctgtcccctgctgcctcctgaccaagcctcctcctcctccag
CTGTAACGTGGTGGCCATCCCTGGGAATGCAAGCATGGATGCAGTCTGCACGTCCACGTC
CCCCACCCGGAGTATGGCCCCAGGGGCAGTACACTTACCCCAGCCAGTGTCCACACGATC
CCAACACACGCAGCCAACTCCAGAACCCAGCACTGCTCCAAGCACCTCCTTCCTGCTCCC
AATGGGCCCCAGCCCCCCAGCTGAAGGGAGCACTGGCGACTTCGCTCTTCCAGTTG
gtaagtcgcaagaagtctcattcattcactccttctgtctgcctgtctttctgtctctct
ttcttcctctcccatggttttactgagagcccacggggggctggaccctgtgccctgtcc
tgggatacaggtggcagtgagactgctttctccccacacctggtgctatcattcaaaatc

 4.08 Intr +  28153  28230   78  2  0  127   69    19 0.869   3.92
ttaggctgaatgaggcacacagacatgattgctttgtaattggatttgagaatctccggc
ctagactcgcccctcatttgcaatgacccgaagcaccttgggtccctggcttgcctggct
ggcccctggtacatttgagtttgttttctgtagctgtctgagcttctcttttctttctag
GACTGATTGTGGGTGTGACAGCCTTGGGTCTACTAATAATAGGAGTGGTGAACTGTGTCA
TCATGACCCAGGTGAAAA
gtaagagtccatccttccttccttcatccacttgttcaggaagcttttgtggggtgcctc
ctgtgagtccagcactgggcacagccttaggggtcagacagagctggatatgggggtcct
tgttctgtaggagcttaaggcctggggtgaaggtacctctgctaacttaattactaaaag

 4.09 Intr +  30623  30751  129  0  0   58   37    92 0.177   2.27
gagctgagatcacaccactgctctccagcctgggcaatagagcaagactccatctcaaaa
gaaaaaataaaataaaataaataaataaaatatcttacttagttgtgggggctgtcccgt
gctattcagcagcatctttggtctttatttacttacatgccagcctcattcccactccag
TGGTGACAATCAAAAATTCTCCAGACATCACCAAGTGTCCCCTGGAGGGCAAAATCACCC
CTAGTGGAGAACCACTGCTCGAGGGAACAGCTCAGCCCTGGGCAGCCCAATACCCGAAGC
TTACACCAG
gtgtttggaatcagatagattgatttcatcccctgattttggtgacaagaaaagagatgc
agggaggaaaactgagttgctcaaggtcgcaccgcagtgtgtctctggactcccatctca
gtgctctttgccctgccctacagtatttcagtggggaggaaattttctcattccccggcg

 4.10 Intr +  33461  33584  124  0  1  102   37    39 0.201   0.35
acctggggctgcttgaactttgcgacttgtggcttgggaggagggaggtggccgtgacct
ttgggggtttttgttctgcctggctgtagccaccagcagagggggtggggcacaggccag
aaaaaccccttttgtggggttgtgaggagtgacaattggctgcttctcctccccttccag
GCTCAGAGCAGGGCTGGGGGGCAGTTGTGGGCAGTGACCAGGGTCAGACCACCTGGGCGG
AGGTTCAGCATGAACTTGCAATGCCCTCCATCTCTCCAAAACTGGGGGACCCAGCCCAGG
GAGG
gtgtgggggttcctggggaagctggtctaggcttctgctcctgccacggaccagctgtgt
gatgctgggcacaggatgcactttctctgggcctccgtggcctcttggggatggcttgca
cgagatccctccagtcctgagtgagaggctgtggccttggggaattaagggtgcaggtgg

 4.11 Intr +  35818  35914   97  1  1   59   66    58 0.861   1.21
tgaggtaggctattattctccctttatagagtaaaaaaaaaaaaaaaggcacagagaggt
taagtaacttgtccaaggtcacacagcaagtgagtggtagagtcatgatttgcacttgtg
tggcctgggtttagagtccacactcttggttgctaggctgggccatgtctccctgtgcag
ATGGGGTGAAGGAAAGCTGCTTTCCTTCTACTCCCTTATGCAAAATAAGGATGAAAATCC
TGCCCCACCTCTAAGACTATTTGGTGAACAGGGCCAG
gtattctctgccctcataggacactctagtagagcagctgggtgctaataacagaaacac
agaaaccacggagaatcacacctcccaaaaagtgccgtgtgtggaaagaacgtgcaaggg
tgggcagaaacgtcacgtaaactgagaagtgctgatggcaggaggtgtggatggcagtgg

 4.12 Intr +  36165  36369  205  2  1   92  110   164 0.973  18.30
gagaatcacacctcccaaaaagtgccgtgtgtggaaagaacgtgcaagggtgggcagaaa
cgtcacgtaaactgagaagtgctgatggcaggaggtgtggatggcagtgggaaggaagag
gggaagaaagagctggctggtgggctgactgctctcccctaccaccccctgcccatccag
CCTCACTTGCCTGCCGATAAGGCCCGGGGTACACAGGGCCCCGAGCAGCAGCACCTGCTG
ATCACAGCGCCGAGCTCCAGCAGCAGCTCCCTGGAGAGCTCGGCCAGTGCGTTGGACAGA
AGGGCGCCCACTCGGAACCAGCCACAGGCACCAGGCGTGGAGGCCAGTGGGGCCGGGGAG
GCCCGGGCCAGCACCGGGAGCTCAG
gtaagaggtgggagcacacctggcttcttcccaagcctccttggtctttctcacctggtt
tctgtcttagccatctcctcctgagcctccccgcagggtgggacgaggcctgagccacag
ggaacttccttcggttcgctgaacctaagttccctcccgcctttgcccatgctgggccta

 4.13 Intr +  36705  36770   66  1  0  127   93   -23 0.723   1.47
cccgcctttgcccatgctgggcctatcacctcaaaatcctcccttctgtgggacaacccc
agcttgtccaagtccctggtatctgggggaggagttttcctgaaaccttctccctgctac
cacccccagctggcctggctgctcctccgggctcaccatgccctggcctccctttcacag
GACTGTCAGACTGCATGTACAGACATTGTCTTCTCCTGTCTCCCACGCCAGGCTGTGGGA
CACCTG
gtgagcctggatcatctcattcatccctgtatctgcaggcccaacacggcccagctactg
ataattaatcataacaatcgcttctacttatggaaggctacggaacagcaggcactgtac
tgggcactttacatgcataaaactgacctgcatgtcaatgctaagagatagttcctgttg

 4.14 Term +  40938  41218  281  1  2   88   41   353 0.720  26.55
aggcacatgcaggttaagtgacttgctcaaggtcacacagcagagctgggctagaatctt
ggtctcggctcctggcccagtgctctttcccatgtgtctgaatctgcatcttgggcaggg
gtccctgggccccactcctggacccccggactgacccccaccccatcttgtgcttagcag
ATTCTTCCCCTGGTGGCCATGGGACCCAGGTCAATGTCACCTGCATCGTGAACGTCTGTA
GCAGCTCTGACCACAGCTCACAGTGCTCCTCCCAAGCCAGCTCCACAATGGGAGACACAG
ATTCCAGCCCCTCGGAGTCCCCGAAGGACGAGCAGGTCCCCTTCTCCAAGGAGGAATGTG
CCTTTCGGTCACAGCTGGAGACGCCAGAGACCCTGCTGGGGAGCACCGAAGAGAAGCCCC
TGCCCCTTGGAGTGCCTGATGCTGGGATGAAGCCCAGTTAA
ccaggccggtgtgggctgtgtcgtagccaaggtgggctgagccctggcaggatgaccctg
cgaaggggccctggtccttccaggcccccaccactaggactctgaggctctttctgggcc
aagttcctctagtgccctccacagccgcagcctccctctgacctgcaggccaagagcaga

Predicted peptide sequence(s):


>TNFRSF1B_1|GENSCAN_predicted_peptide_1|44_aa
MAPVAVWAALAVGLELWAAAHALPAQKYQGPVSEEQDQRDPSQA

>TNFRSF1B_1|GENSCAN_predicted_peptide_2|206_aa
MRNGQEMDLQREGAASSEQQTECTSVQVTAAHGLLHHHLIGGLGNGVRLHQKKKEKEKEK
EKEKEKEKEKEKEKEKEKEKEKEKEKKKKKKKKKKKKKKWSLRDAEWLVTAHRKDRLDAR
AEPEPWDAPPTALPPHSPLHTWGSRLGQKSMISSNPPSANRHFLLRGSQPSTSNHSDITA
TCDITTRHSGKRLWVPERAIIKVKVR

>TNFRSF1B_1|GENSCAN_predicted_peptide_3|85_aa
MDLSWTSAVSKPVRADTSHDTQHRWASADLAKFPPANVAEHTLIIRPPGLSKGGQLEQAT
SERKGPEMSPFPGVLDTGLVEGALT

>TNFRSF1B_1|GENSCAN_predicted_peptide_4|673_aa
MATIVMVITNIQLMSAGSTVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFC
TKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSEWCACSCCEEQDCGEERNCWEERDC
GEERDFGEERHCGEEQDCREERDCGEERDFGEERDCGGRARLRGTSRTAESSGTAESSGT
AESSRTADQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTE
TSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVH
LPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLI
IGVVNCVIMTQVKMVTIKNSPDITKCPLEGKITPSGEPLLEGTAQPWAAQYPKLTPGSEQ
GWGAVVGSDQGQTTWAEVQHELAMPSISPKLGDPAQGGWGEGKLLSFYSLMQNKDENPAP
PLRLFGEQGQPHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQA
PGVEASGAGEARASTGSSGLSDCMYRHCLLLSPTPGCGTPDSSPGGHGTQVNVTCIVNVC
SSSDHSSQCSSQASSTMGDTDSSPSESPKDEQVPFSKEECAFRSQLETPETLLGSTEEKP
LPLGVPDAGMKPS