GENSCAN 1.0	Date run: 14-Jan-104	Time: 20:34:05

Sequence THBS3_1 : 14691 bp : 56.21% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1222   1300   79  0  1   82   98    86 0.960   8.19
gttcccagagctgatgatgcctccagggtgattggcagctctttgtttcagccccccctc
acccgcctgctggccccccctccaattctgtccctccgccccccggctcctgctctctcc
gcctagccttttcccctcccagctgcctgcctgccaggggtagtgagccggctgagaggc
ATGGAGACGCAGGAACTTCGGGGGGCCCTGGCTCTTCTCCTCCTTTGCTTTTTCACATCT
GCCAGTCAGGATCTGCAGG
gtaagcctgtctccatcctcttagaccgctctctgcttcttccccatttgccctcagccc
aagtagcagagaacatgtgggcaaggggagaggggaagagtccagaaattgagccagagg
aaaacttaagactgcctagagttggtgaaattatggcctggtggagaggagtgggcaccg

 1.02 Intr +   2692   2898  207  2  0   49   57   257 0.996  18.27
tgcctcaacctcccaaggtgttgggattacaggtgcgagccaccatgcccagccaagggt
tgaattttgaggtgactaacgctgcctggtggtgggggtagggggtgatgtgggctcggg
ggagggcataccttagcatttgatcccattctctaaccttgataacccctgcctgaccag
TAATTGACCTGCTGACTGTGGGCGAGTCTCGGCAGATGGTAGCTGTGGCAGAGAAGATCC
GGACAGCCTTGCTCACTGCTGGGGACATCTACCTCTTATCCACCTTCCGCCTGCCCCCCA
AGCAGGGTGGTGTCCTCTTTGGCCTCTATTCTCGCCAAGACAACACTCGATGGCTGGAGG
CCTCTGTTGTAGGCAAGATCAACAAAG
gtgactggtgggcatctcctttcttgcaatggtgacctccttaagcactctccctcatcc
ctacttcccaagtgcttcctcattctccttggcctccattagggaccaaggtcccatcag
gctgtgcccagacatcaggggcacctggtatggggtgcttataaggtgctttaggagccc

 1.03 Intr +   3782   4038  257  0  2   62   99   154 0.985  11.60
ctctaaagcaatttcaaaaacatttattgtgtacctattaaatacaaggtgttgagagcc
acatagtagaattagggataggggccctagagatgtggtatctagcagagttgatccaag
gctcagctgggaggcagggggtgggggatagcgcccatactgatctcccctcctgggcag
TACTGGTGCGATACCAGCGGGAGGATGGCAAAGTCCACGCCGTGAACCTACAGCAAGCGG
GCCTGGCTGATGGGCGCACACACACAGTTCTCCTGCGACTCCGAGGTCCCTCCAGACCCA
GCCCTGCCCTACATCTCTACGTGGACTGCAAACTGGGTGACCAACATGCAGGCCTTCCAG
CACTGGCCCCCATTCCTCCAGCGGAGGTCGATGGGCTGGAGATTAGGACTGGACAGAAGG
CGTATTTGAGGATGCAG
gtgagccgggaggagcctctgagttctgtggaaatagagtttgcaccagctggggaaggg
gttggtagaccttcccaccttactctgctgctatccccccagggctttgtggaatctatg
aaaattattctgggtgggtccatggcccgggtaggagccctgagtgagtgtccattccaa

 1.04 Intr +   4141   4243  103  0  1  114   92    37 0.977   6.95
gcactggcccccattcctccagcggaggtcgatgggctggagattaggactggacagaag
gcgtatttgaggatgcaggtgagccgggaggagcctctgagttctgtggaaatagagttt
gcaccagctggggaaggggttggtagaccttcccaccttactctgctgctatccccccag
GGCTTTGTGGAATCTATGAAAATTATTCTGGGTGGGTCCATGGCCCGGGTAGGAGCCCTG
AGTGAGTGTCCATTCCAAGGGGACGAGTCCATCCACAGTGCAG
gtaacacagagacttgtttgctgacattggaccacggatcctgtggcctttggtgactcc
tgtcttcttgatctccctctcccttaaaacccattcctttggctcacctgttcctagggt
ttctaaccctgttattccaaatctttcacctgactccacaatctccaatacacccatccg

 1.05 Intr +   5559   5585   27  1  0  133   95   -16 0.818   2.17
ccccatagaaggagctggcactgcttgtctgccagctctgccctcccagcatccagcacc
ccatctttattctggggctccagccctgtccctgtcctcaccttccttcctccttctcac
caaccaggcctctcttcacttcacctcacccctctgactatgttttcttctcctctccag
TGACCAATGCACTGCACTCCATTCTAG
gtgagtaggccacactgaagcggaagcggggagcggggaggaggccccaggctctggcag
ctgcctgaaactaagtcctcttcagtcaggaatgtagtaggtttaaaggcaggggtgggc
agccgtggcaggtactggcttattgcccatggagggcccaggactggtgctccagtactg

 1.06 Intr +   5793   5881   89  1  2   80   43   198 0.564  14.69
ggggagcggggaggaggccccaggctctggcagctgcctgaaactaagtcctcttcagtc
aggaatgtagtaggtttaaaggcaggggtgggcagccgtggcaggtactggcttattgcc
catggagggcccaggactggtgctccagtactgaacccctcacaccctgggtcccgacag
GGGAGCAGACCAAGGCGCTGGTCACCCAACTCACCCTCTTCAACCAGATCCTGGTGGAGC
TGCGGGATGATATACGAGACCAGGTTTGG
gtgggctggcgaagggtggcactgattctggggtagggtggcagatgtcaagtgctgact
cctccccatccttctccaggtgaaggaaatgtccctgatccgaaacaccattatggagtg
tcaggtgtgcggtgagtgggagagcaggggaggctccacatgaccgtgccacgttcccca

 1.07 Intr +   5961   6012   52  2  1  123  101    32 0.998   6.97
gggtcccgacaggggagcagaccaaggcgctggtcacccaactcaccctcttcaaccaga
tcctggtggagctgcgggatgatatacgagaccaggtttgggtgggctggcgaagggtgg
cactgattctggggtagggtggcagatgtcaagtgctgactcctccccatccttctccag
GTGAAGGAAATGTCCCTGATCCGAAACACCATTATGGAGTGTCAGGTGTGCG
gtgagtgggagagcaggggaggctccacatgaccgtgccacgttccccacccaatggctt
tggctttcccttctggtggcttaaatagtgaccaccgggtagctctgactgtgtccaccc
ctcaggcttccatgagcagcgttcccactgcagccccaatccctgcttccgaggtgtgga

 1.08 Intr +   6138   6286  149  1  2   67   78   225 0.784  19.86
caggtgaaggaaatgtccctgatccgaaacaccattatggagtgtcaggtgtgcggtgag
tgggagagcaggggaggctccacatgaccgtgccacgttccccacccaatggctttggct
ttcccttctggtggcttaaatagtgaccaccgggtagctctgactgtgtccacccctcag
GCTTCCATGAGCAGCGTTCCCACTGCAGCCCCAATCCCTGCTTCCGAGGTGTGGACTGCA
TGGAAGTGTACGAGTACCCAGGCTACCGCTGTGGGCCCTGCCCCCCTGGCCTGCAGGGCA
ACGGCACCCACTGCAGTGACATCAATGAG
gtgagggaggtcagagcccagaagggtacagaaaactggggtgaggatgtcaggaggcac
ccaagagggtgggataaatgctggtccggaggagaggaatctggagtttaggagaggtca
gaggcaagagaaatgcaagatgggagagacagaaggcctggggcaaagactgaaggccat

 1.09 Intr +   6697   6837  141  0  0  114   71   151 0.987  17.06
tggcatggggagggagagagggaaccccgagggaagtggggtggggaccaggagcacaag
gcagttgtgtggggagagctgcacaaaggggagacctggagcaatggttcctggatcaca
ggcagggacctgagtttcccagagggcggcctgacctctgccttctcatctggtccccag
TGTGCTCACGCTGACCCCTGTTTCCCGGGCTCCAGCTGCATCAACACCATGCCCGGCTTC
CACTGTGAGGCCTGTCCTCGAGGGTACAAGGGCACACAGGTGTCTGGTGTGGGCATTGAC
TATGCCCGGGCCAGCAAACAG
gtcagactgggtagtgtgtgtggacaagggatcttggccttgtagaggccaggggcttct
gggttggacatgggacccttgtgatgaatgggacatggatggctttgcatcggctttggg
tctgggcttaatgttgatgttcacagataaggccataccagtgtcctctgctgtatctga

 1.10 Intr +   7064   7141   78  1  0   62   77   147 0.987  11.24
ggccaggggcttctgggttggacatgggacccttgtgatgaatgggacatggatggcttt
gcatcggctttgggtctgggcttaatgttgatgttcacagataaggccataccagtgtcc
tctgctgtatctgaggagacccaccataggtctggttccacccaaagtctgccccttcag
GTCTGCAATGACATCGATGAATGCAACGATGGCAACAATGGTGGCTGTGACCCAAACTCC
ATCTGCACCAACACTGTG
gtgagctgaatatcctgagtgtattctggggtggtgggaatggtaaaaccccaacccccg
ccccttcttaccttcaaatttcctgctgcctttcctcctccccagggcactacacagatt
aggtgttcacatggacttggtttggaatactggtttgcctcttgctagctctttagcagg

 1.11 Intr +   7894   8004  111  0  0   76   61   119 0.982   9.08
gagggtctggggaaaggagtagggctatgtttagggcctgggttgggggtcttcatagga
gagaggtgggcctgggcccaggaactgtttggtggggagaataggacctgaagcagggaa
aatatagggaggaggggagccagaccaaactgctagctcctaccctttgtgttgccctag
TGTAACGTGGGCTGGGCTGGGAATGGGAACGTGTGTGGGACTGACACAGACATCGATGGC
TACCCAGACCAAGCACTGCCCTGCATGGACAACAACAAACACTGCAAACAG
gtgcagggagcaggcgggcaagggggcgtagtggggagcccaagctgggtcaggccagaa
ctcatccatcctcttcccctgaactttaggacaactgccttttgacacccaactctgggc
aggaagatgctgataatgatggtgtgggggaccagtgtgatgatgatgctgatggggatg

 1.12 Intr +   8094   8201  108  2  0   75   47   138 0.953   9.38
gaatgggaacgtgtgtgggactgacacagacatcgatggctacccagaccaagcactgcc
ctgcatggacaacaacaaacactgcaaacaggtgcagggagcaggcgggcaagggggcgt
agtggggagcccaagctgggtcaggccagaactcatccatcctcttcccctgaactttag
GACAACTGCCTTTTGACACCCAACTCTGGGCAGGAAGATGCTGATAATGATGGTGTGGGG
GACCAGTGTGATGATGATGCTGATGGGGATGGGATCAAGAATGTTGAG
gtgactcccagactgccctgccccttgaagctcctctcccctcctcctgtcctctctgtg
cctcacttacctcatctggcagctctctagtaagggccaaatactccaaatcagggaggc
aaaaacctcgtgcccaggacaaggaggctgggtgggtgggactgtactgagcagtttgtc

 1.13 Intr +   8488   8647  160  0  1   99   16   248 0.999  18.77
caaatcagggaggcaaaaacctcgtgcccaggacaaggaggctgggtgggtgggactgta
ctgagcagtttgtccatcacaagggtgtgatcttagaaaaggatacagagacaaggtagg
tgcaagatgacaagtgatttaggggagacctgacccttcccctcccacccctctgcccag
GACAACTGCCGGCTGTTCCCCAACAAAGACCAGCAGAACTCAGATACAGATTCATTTGGT
GATGCCTGTGACAATTGCCCCAACGTTCCCAACAATGACCAGAAGGACACAGATGGCAAT
GGGGAAGGAGATGCCTGTGACAACGACGTGGATGGGGATG
gtgcaggcctggggctgaaggggtggctgggggacctgtgagaatttggatcaggtgggg
atgaagcagggaagctaggaagtctctgtgaaatagggaggcaggcttgtggacgttggc
ctgggtgaggagagattacctgcagcagatgtcaataggaatgtgaggtagggcgtagtg

 1.14 Intr +   8985   9103  119  1  2   94   92    79 0.981   9.59
ggaatgtgaggtagggcgtagtgttaggcagagtgtggactagagggtgagacaagaaac
aggcagatttcctggccagttgtcctctgggtggggagacaaagttcgggactttcacca
acctagaagagagaatatggcatgttctagtaacaaccttgtgctacccatgtcttctag
GCATCCCCAATGGATTGGACAATTGCCCTAAAGTCCCCAACCCACTACAGACAGACAGGG
ATGAGGACGGGGTGGGAGATGCTTGCGACAGCTGCCCTGAAATGAGCAATCCTACCCAG
gtacagggagatggtaaggacaggggagggatgagggtactgatggatgaagccccagcc
ctttggatggaaagtggtcagatcaccctcttcagagttatcaagaggagatggtgagaa
caggtccctctctctcagacagatgcagacagcgacctggtgggggatgtctgtgatact

 1.15 Intr +   9242   9294   53  1  2   27  110   100 0.987   4.29
gatgcttgcgacagctgccctgaaatgagcaatcctacccaggtacagggagatggtaag
gacaggggagggatgagggtactgatggatgaagccccagccctttggatggaaagtggt
cagatcaccctcttcagagttatcaagaggagatggtgagaacaggtccctctctctcag
ACAGATGCAGACAGCGACCTGGTGGGGGATGTCTGTGATACTAATGAAGACAG
gtaaggtcttggtcaagagacgcaaggtctttcttttttttgtctttctgagacggagtc
ttgctctgtcacctaggctggagtacagtggcacgatcttggctcactgcaacctccgtc
tcccagggtcaagtgattctcatgcctcaacctccctgagtggctaggattacaggcatg

 1.16 Intr +  10496  10689  194  2  2   47  103   280 0.945  25.06
agcaggaatttattcttacagtcatccctccattcctactgccagaccttcacctcacct
ggctgactgccaggggtctgattgtatggagagcaggctccagagactcccaggcagaag
cgaagggaaggacaaggagtacctttaaatcctttatttggtacctgttcttctgattag
CGATGGGGATGGGCATCAGGACACCAAGGACAACTGCCCACAGCTGCCAAATAGCTCCCA
GCTGGACTCTGATAACGATGGACTTGGAGATGAGTGTGATGGGGATGATGACAATGATGG
CATCCCAGATTATGTGCCTCCTGGTCCCGATAACTGCCGCCTGGTACCCAATCCCAATCA
GAAGGACTCAGATG
gtaagcctgcggacccagagcacgttagactggtgttgcctttgcccaggtggaggcagc
aagccctgttgggaagtgaggaagggcaaggtggggaaagatgtcaggaatgcaggccca
acagatggtattgttgcctaatggcagtggccagggccttcctgagcacccagcctcact

 1.17 Intr +  10878  11056  179  1  2   58   93   269 0.997  24.56
gcggacccagagcacgttagactggtgttgcctttgcccaggtggaggcagcaagccctg
ttgggaagtgaggaagggcaaggtggggaaagatgtcaggaatgcaggcccaacagatgg
tattgttgcctaatggcagtggccagggccttcctgagcacccagcctcactctgcccag
GCAATGGCGTTGGTGATGTGTGTGAGGATGACTTTGACAATGATGCTGTGGTCGACCCCC
TGGATGTGTGTCCTGAAAGTGCAGAGGTAACGCTTACGGATTTTCGGGCCTATCAGACCG
TCGTCCTGGATCCTGAGGGTGATGCTCAGATTGACCCAAACTGGGTTGTGCTCAACCAG
gtaactcggggcagtgggctgggcaggtgctatcagacagggctactgggacggggggcc
tgggagggatagcacacctgcatcacagctttttctttactatacaaccccagggcatgg
aaatcgttcagaccatgaacagtgaccctggcttggcagttggtatgtaagggatatgca

 1.18 Intr +  11170  11218   49  0  1   56   76    57 0.995   0.04
tcagaccgtcgtcctggatcctgagggtgatgctcagattgacccaaactgggttgtgct
caaccaggtaactcggggcagtgggctgggcaggtgctatcagacagggctactgggacg
gggggcctgggagggatagcacacctgcatcacagctttttctttactatacaaccccag
GGCATGGAAATCGTTCAGACCATGAACAGTGACCCTGGCTTGGCAGTTG
gtatgtaagggatatgcagttcaatcacttccaaatggaggaatcctataggggcagagg
gtaggggaggaaacagacagggagaatgggcaaagtggcgagagagaaggcagtggcaca
agctggccacatacatagcaggcatcccttcccaactttaccccatgatgggccgccagt

 1.19 Intr +  11439  11635  197  1  2  109   25   340 0.992  29.45
gaatcctataggggcagagggtaggggaggaaacagacagggagaatgggcaaagtggcg
agagagaaggcagtggcacaagctggccacatacatagcaggcatcccttcccaacttta
ccccatgatgggccgccagtagctttgctgcccctgacctttatcccacccccaccccag
GATACACGGCCTTCAATGGTGTGGACTTTGAAGGCACCTTCCATGTGAACACAGTGACTG
ATGATGACTACGCAGGCTTTCTCTTCAGTTATCAAGACAGTGGCCGCTTCTACGTAGTCA
TGTGGAAGCAGACCGAGCAGACCTACTGGCAGGCTACACCCTTCCGGGCGGTTGCCCAGC
CCGGGCTGCAGCTCAAG
gtccccagctgctcagattccgcaacccagggccctttcccaaagctctcctctgcagcc
ccagggcctcccccactgcttgactgggaaccctcttacccagacatctggcttggaggc
cggctctctggggccccagggcattttcatgaccgccttgaatccctttcccacctgcac

 1.20 Intr +  11885  12057  173  1  2   85   99   200 0.999  20.06
cccccactgcttgactgggaaccctcttacccagacatctggcttggaggccggctctct
ggggccccagggcattttcatgaccgccttgaatccctttcccacctgcacttaccgacc
tgttgtctcccctcactccagttctgcagttgacccactgtctttgccaatgtctcctag
GCAGTGACATCAGTGTCTGGCCCAGGTGAGCACCTCCGAAATGCCCTGTGGCATACTGGC
CACACCCCTGATCAGGTACGACTGCTGTGGACAGACCCACGAAATGTGGGCTGGCGGGAC
AAGACCTCCTATCGCTGGCAGCTTCTGCACCGGCCTCAAGTTGGCTACATTCG
gtaaggagaggggctgagcccacctgtgggactcaggccgggcctgtccttcctctttag
ctgggattcaccagtgacctctccatgggtgggaactgcagccacttctctccatcaccc
ttctcaccacggacacaagcacctatgagtgatgttggtgaagtcactcctccatgaccc

 1.21 Intr +  12861  13111  251  0  2  144   77   132 0.971  15.32
gacttcaccccccagcccattgtgcttattgtcatggcaacccaatcctcgcttggaatg
cggctggtgctttgagatgcaaaaggagctggacaaagagctaggggccccaggcctgag
aaaagcaccccccttccctctccttcctgcctccctttccctccctcccttctctctcag
GCCTGGTGAGCTCAAGGGGGGCTGGGGAAAAGCAAGGCCCCAGGCATGGTGGCACAGTGC
CCACTGGCACCCTAGCACCAATGGATACTCCTATCCTGGAATCCTGGACAGGGTGAAGCT
CTATGAGGGACCCCAGCTTGTGGCGGATTCTGGGGTGATCATTGACACATCCATGCGAGG
GGGGCGTCTTGGTGTATTCTGCTTCTCCCAAGAAAACATAATTTGGTCCAATCTCCAGTA
TCGATGCAATG
gtgaggtggctgattgagatcaacctaatccttcatgccttgtgggagagccacatcctc
tgaccttacttatttccccttcttcagacacagtgcctgaggactttgagccattccgga
ggcagctgctccagggaagggtgtgaggaggaggccaccagattcagaattcagaatttt

 1.22 Intr +  13199  13251   53  0  2  119   41    62 0.427   3.72
tcattgacacatccatgcgaggggggcgtcttggtgtattctgcttctcccaagaaaaca
taatttggtccaatctccagtatcgatgcaatggtgaggtggctgattgagatcaaccta
atccttcatgccttgtgggagagccacatcctctgaccttacttatttccccttcttcag
ACACAGTGCCTGAGGACTTTGAGCCATTCCGGAGGCAGCTGCTCCAGGGAAGG
gtgtgaggaggaggccaccagattcagaattcagaattttagaccctttggccttggggt
ccatcctggagaccctgaggtctaagctacagcccctcagccaaccacagacccttctct
ggctcccaaaaggagttcagtcccagaggggtggtcaccccacccttcaggggatgagaa

Predicted peptide sequence(s):


>THBS3_1|GENSCAN_predicted_peptide_1|943_aa
METQELRGALALLLLCFFTSASQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTVLLRLRGPSRPSPALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVWVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGY
RCGPCPPGLQGNGTHCSDINECAHADPCFPGSSCINTMPGFHCEACPRGYKGTQVSGVGI
DYARASKQVCNDIDECNDGNNGGCDPNSICTNTVCNVGWAGNGNVCGTDTDIDGYPDQAL
PCMDNNKHCKQDNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQN
SDTDSFGDACDNCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDR
DEDGVGDACDSCPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLD
SDNDGLGDECDGDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVV
DPLDVCPESAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGY
TAFNGVDFEGTFHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPG
LQLKAVTSVSGPGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGY
IRPGELKGGWGKARPQAWWHSAHWHPSTNGYSYPGILDRVKLYEGPQLVADSGVIIDTSM
RGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGR