GENSCAN 1.0	Date run: 14-Jan-104	Time: 18:55:23

Sequence TDRKH_1 : 21355 bp : 43.84% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    458    530   73  1  1   69   31   145 0.972   6.13
caggacagcgtctggaataaaatcttccaaagcaaacttccgcctgcggagacccgctcc
cttcctcgcccccacagaaacgccccccgccaccaccccctcccccggcgtaggccttca
cgctgtcgcctcgacccgtttcctcgaatccccagggaagggtgggcccctggcgcccct
ATGGCCCGCCGCCCCCTTACCACCGCGGTCGGAGCCCGGGTCTCACTCTCCTGCCGCTGT
TTCGGGCCACACC
gtgtgtccgtgcctccgcaaaggaatagaagagtgggtcctcgctctctgcggcgcaccg
cttgtcccttgacttcctgtccatctacaaagcctatttcatgttttccagaaagaaaac
gttttccgtgtctcttgagtcctcatcgccatatgcggggcgggaccgatctatgcaaaa

 1.02 Intr +   1034   1343  310  0  1   69   42   219 0.533  10.77
cggtcccagctgctggagcgcagattttcctccaagggttagaagatagaaaactcctcg
gtaattggcctagaggtggtctgcgaggacgccgggaagcttgtaattggctgtttaatt
ctcagcaggtgcggtctcagttaacaacatctgcttttcctggatcttattggctgacag
GGTGGGCCTGCTTTGGATTCCATCCGGGTAATTGGGCAGCGGCTAGCAGCAGCCACGTCG
CTCAGGGGCAGCCCGCGGAAGGATTGGTTGTGACGGGAGAAGGCGATTGGTCGGACTGCG
AGCAGGGTGTTGATTGGTGCTGTCGGGCTGCGGGGGCGGGGAAGTGGCGGCTGAAGCGCC
GCCGGCGGGGCTCACTGTGGTGGTGTGAGTGGGAGGCGGCGGCGCTGGTGGCTGCAGCTG
GGGTGAGGCGCGAGGCGGCGCACTCGACGGCTGACTGGAGCAGCGGTAAAGGCGAGGATG
GAGACCGAAG
gtttggggagtgggaaagacagggtcatgggcagccctggccactaggagacggaaatgc
gggagcgagggaagggaggggtctggcgtgccccggggcgagggaaggatgtggggcgca
gcgggggagtcagagccctgggctgtgagacgccgctcgggggcaacttgacccactggg

 1.03 Intr +   2499   2598  100  0  1   -4   47    89 0.359  -4.29
gtactatgcagttatccccgtttacattatattattttccatttctctttaagagaaact
tatagctgaaaggatatgaaaattgtgaacaaaaccatagtgacagatcaagtagagtct
cattttttgagacatcagctgataactcaattagcacaaattcatttgtaatgtttgaag
AGGAGTTAGTGAAATTTACCTTTTGCTTCAAATAGAAGTCGGCCAAAACCGCACCTATAA
TCTCAGCTACGCCGGACGACTGCGGGAGTTCAAGGCTGCA
gtgagctattatcattcactgcattccatcctgggtgacagaccaaggctctgtctctaa
ataaacaacaacaaactctccaattcatctgttctccatctccatcattgacacctggac
taggccctgattggtctcctgcagccacggttgctgccttcaattcattctcctcaccac

 1.04 Intr +   8674   8824  151  0  1  117   94    82 0.970  11.44
acttttaaaaaataccctgagccctttttatatgaaataaattttgaaattgctgaagct
cttgaaattggaaggtaggcagtagtagtcttttcagtaataatgtgctcccatgcctct
ctgctattcataaaaggattggatgaaacctccctcttttccctgctttgcttgtttcag
GATATAAGTCAAAGAGTACAGCAGAAAATGTCTACTGAACGGACTTCTTGGACAAGCCTG
TCCACCATTCAGAAAATAGCCCTGGGCCTTGGGATCCCAGCCAGTGCAACAGTTGCCTAT
ATCCTATACCGCAGGTATAGGGAAAGCAGAG
gtacgtgaaccctatgactgtgtgtgtgaaaatgttcagacatgctcctgccttgttaaa
ttgaaaaaaactctttccttgccaggtattgtgtgtgttttgttttggggttttttgtgg
ggtttttttgagacagggtctcactctgtcacctagcctggcgtacagtggcacaatctt

 1.05 Intr +  10136  10242  107  0  2   34  111    99 0.981   6.73
gatcctttgggaccttctaattcccattcagatgccacttttccttgttgttatggttga
gatcctcactttatctcttggatcagtgtctctttgacagccagattctggggaggactg
gtagttatactagctttgggtgttatctaagtctgatctgatgaacaatgatctgtgcag
AAGAGCGGCTGACATTTGTTGGGGAAGATGACATTGAGATAGAGATGCGGGTTCCCCAGG
AGGCTGTGAAACTCATCATTGGCCGGCAAGGAGCCAATATTAAACAG
gtaagtgtgtgagtaggcagtctgctttcccaaggattgattctgtttattgatttcttg
tttccttccactgaccccatatcacaaaacattcacatgctctgtgtgtgtgtgtatgtg
tgtgtgtatatataaaatatatatatatatattttttttttttgagatggagtttcgctc

 1.06 Intr +  11583  11672   90  2  0   97   69   143 0.790  13.49
ggttgtatagatagtaactgaggttgtatataaagtaattgaggactggttgtatagata
gtattagctaattcctttggctaattctatctacctccagggtttgttttagagtgtctg
tagctgggctcaaatgggagctcttccagaatgtactgccaaatgtccttttctttgcag
CTGCGGAAACAGACAGGTGCTCGGATTGATGTGGACACAGAGGATGTAGGCGATGAGCGA
GTGCTGCTTATCAGTGGTTTTCCTGTTCAG
gtgtgcaaggccaaagcagcaatccatcagatcctgacagagaataccccagtgtctgag
cagctttcagttccccagagatctgtgggcagaatcataggtaccactggatggcttcct
ctattgtttcctttattctttacctttgcccctctttcacaccttcccagggttttttct

 1.07 Intr +  12717  13038  322  2  1   93   53   273 0.897  19.73
tgtgacaaagaatcagaagggacattactactatcaagacttataaaaatctcaggaaca
cagaaggaagtggcagcagccaaggcaagtagctaatagacttgaattatacctgagcat
gagaagatccttttactctatcccaggtcagaatatcatcctttctcttgttttccacag
CATTTGATACTGGAGAAAGTTTCAGAAGATGAAGAACTTCGGAAGAGAATTGCTCATTCT
GCAGAAACCAGGGTCCCACGCAAACAGCCAATCAGTGTGAGAAGAGAAGACATGACAGAG
CCAGGTGGAGCTGGAGAGCCAGCATTATGGAAAAACACCAGTTCTAGCATGGAGCCGACT
GCACCCCTGGTGACTCCTCCACCCAAAGGAGGAGGCGACATGGCTGTGGTAGTGTCAAAG
GAAGGTTCCTGGGAGAAACCTAGTGATGACAGCTTTCAGAAGTCTGAAGCCCAGGCCATC
CCAGAGATGCCCATGTTTGAAA
gtatgtaacaaagagggagcccattaatcattgaagatagaaatactggcttagatattg
gagagattagaaggaatgccttctcagtctgagcagccagtataatatggctggggtcag
gacagaagattcggtaagatattttgaagatgggatggaggtagaatccacaccaacagt

 1.08 Intr +  15124  15284  161  2  2   73   89   147 0.915  13.01
acaaaggatagcttagtatctttctttaggatattcttgtttgattcatccagttgcctc
tcctgccattttaaaatggtaacagccattggtatttgtacctctcactaccctggttag
tctcttcattccaaccagagatgggtctgatgtggccaccatccttatctctgtgttcag
TCCCCAGTCCTGACTTCAGTTTTCATGCTGATGAGTACCTAGAAGTCTACGTTTCTGCTT
CTGAGCACCCTAACCACTTCTGGATCCAGATCGTTGGCTCCCGCAGCCTGCAATTGGATA
AGCTTGTCAATGAGATGACCCAGCACTATGAGAATAGTGTG
gtgagttgccatagggacagggctggggtttaatgaaaagaaggcatatctttttcattg
tactcttcctttccctgtggagcaactacttttctttcttcctcctgcaattctgtttat
gagcctaccactttgtaactctctgcctttctcctcctccccacatacagcctgaagact

 1.09 Intr +  15455  15627  173  1  2   77   82   151 0.885  12.14
gaatagtgtggtgagttgccatagggacagggctggggtttaatgaaaagaaggcatatc
tttttcattgtactcttcctttccctgtggagcaactacttttctttcttcctcctgcaa
ttctgtttatgagcctaccactttgtaactctctgcctttctcctcctccccacatacag
CCTGAAGACTTGACTGTGCATGTAGGAGACATTGTAGCAGCACCTTTACCTACAAATGGT
TCCTGGTATCGAGCCCGGGTCCTCGGCACCTTGGAGAATGGGAACTTGGACCTCTATTTT
GTTGACTTTGGAGATAATGGAGATTGCCCACTGAAGGACCTCAGGGCTCTCAG
gtcagtgctgaggtcagctcaatcccaactgctgactcagttctggccatagggtggtga
gctgttggcagttgtcagggggatttggaagggaacctgtttacagagagcagatggtta
tcgtctcatgttagttggttctttctgaaagcagcaatgtaagaagatgtttttggcccc

 1.10 Intr +  15839  15903   65  2  2   79   99   -15 0.404  -2.94
ctgactcagttctggccatagggtggtgagctgttggcagttgtcagggggatttggaag
ggaacctgtttacagagagcagatggttatcgtctcatgttagttggttctttctgaaag
cagcaatgtaagaagatgtttttggccccaggattctaattttagtttcttttacttcag
GAGTGACTTCCTAAGCCTTCCATTTCAAGCAATAGAATGTAGTCTGGCACGGATTGCTCC
CTCAG
gtaaattggtcatgccatctattgagcttacctccaaatagaataacttcatacagttca
ttggaaggaattctcacattcccaggctttttgaattctggggactcaggtgccttttcc
tcaccagcactagcagcagccagaaacttgcctggcagacccaacccaaccagagaagac

 1.11 Intr +  16180  16331  152  2  2   61  116    66 0.421   6.58
tctggggactcaggtgccttttcctcaccagcactagcagcagccagaaacttgcctggc
agacccaacccaaccagagaagacacaggtgccttcctgagtagaaaagggtagttccaa
cttccctccagggtataagccccacccctatcagcagtaacccctacaatcttttgccag
GTGACCAGTGGGAAGAGGAAGCTTTGGATGAGTTTGATAGACTCACTCATTGTGCTGACT
GGAAGCCTCTGGTAGCCAAGATCTCTAGCTATGTCCAGACTGGGATCTCAACTTGGCCAA
AGATCTACTTATATGATACTAGCAATGGGAAG
gtaagactggcattcactcactgcttgccatatcttcagtatatttatagcctaatttac
tttttcttcctcagaaacccttatctgatattactcttactgtaagatccttctcaccat
ctcaccaaaggaatgtctttaaagtatcagtccttctgccttgtttcctcaaatttgccc

 1.12 Intr +  16557  16658  102  2  0   81   89    78 0.994   7.57
tatagcctaatttactttttcttcctcagaaacccttatctgatattactcttactgtaa
gatccttctcaccatctcaccaaaggaatgtctttaaagtatcagtccttctgccttgtt
tcctcaaatttgcccttgcttactgagagaacatcattcccttttcatttttcttctcag
AAACTTGATATTGGGCTAGAATTAGTACACAAAGGATACGCAATTGAGCTTCCTGAAGAC
ATAGAAGAAAACAGAGCTGTCCCAGACATGTTGAAGGACATG
gtgagctattgtagttatatagggtgctgcttccaggcaaatctagcacatagacactaa
gggcttctagtcctgatactgtgttagctttcctaaggactttgagctcctccagtagtt
gaccaaaggagcattttgtccctcttggtagccaaatgcaactgccttaaccaggtccta

 1.13 Intr +  16917  17013   97  2  1   90   87    -3 0.783  -0.62
ctgtgttagctttcctaaggactttgagctcctccagtagttgaccaaaggagcattttg
tccctcttggtagccaaatgcaactgccttaaccaggtcctatgagaagaatgaaagggt
ggcctcttttttcctaaaagccaacatgttcctccttttttcctgttttcatccactcag
GCCACAGAAACAGATGCCTCTCTCAGCACGTTGCTCACTGAGACCAAAAAGAGCTCTGGA
GAGATAACACATACCCTGTCCTGCCTCAGCTTATCAG
gtacaagcagtatttcctccctagagcatctttggagattaacttttctcattcagtctt
tccagagtagggaggttaattgaaggcttggttcctagtcaggtcattgagtaccaagag
gtccatttttcttttgagcctcgctggcattgcctgctagaatagggcagtgtctaactt

 1.14 Term +  17219  17271   53  0  2   80   45    56 0.556  -1.91
gcatctttggagattaacttttctcattcagtctttccagagtagggaggttaattgaag
gcttggttcctagtcaggtcattgagtaccaagaggtccatttttcttttgagcctcgct
ggcattgcctgctagaatagggcagtgtctaactttctccttcttatttatcttcaatag
AAGCTGCTTCCATGTCTGGTGATGATAACCTTGAAGATGACTACTTACTCTGA
agtctgggcttcagtttgctcagccatctgctttgctgtgtgagtgcagctatcatctat
ctgtagcaacaggaaagtaatgagggcgacagtggggcacttgctttgattccctctttc
ccatgccctgtcttaatatacttctctgcagctgctttcctgcagcttaacttgctctca

Predicted peptide sequence(s):


>TDRKH_1|GENSCAN_predicted_peptide_1|651_aa
MARRPLTTAVGARVSLSCRCFGPHRWACFGFHPGNWAAASSSHVAQGQPAEGLVVTGEGD
WSDCEQGVDWCCRAAGAGKWRLKRRRRGSLWWCEWEAAALVAAAGVRREAAHSTADWSSG
KGEDGDRRGVSEIYLLLQIEVGQNRTYNLSYAGRLREFKAADISQRVQQKMSTERTSWTS
LSTIQKIALGLGIPASATVAYILYRRYRESREERLTFVGEDDIEIEMRVPQEAVKLIIGR
QGANIKQLRKQTGARIDVDTEDVGDERVLLISGFPVQHLILEKVSEDEELRKRIAHSAET
RVPRKQPISVRREDMTEPGGAGEPALWKNTSSSMEPTAPLVTPPPKGGGDMAVVVSKEGS
WEKPSDDSFQKSEAQAIPEMPMFEIPSPDFSFHADEYLEVYVSASEHPNHFWIQIVGSRS
LQLDKLVNEMTQHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDLYFVD
FGDNGDCPLKDLRALRSDFLSLPFQAIECSLARIAPSGDQWEEEALDEFDRLTHCADWKP
LVAKISSYVQTGISTWPKIYLYDTSNGKKLDIGLELVHKGYAIELPEDIEENRAVPDMLK
DMATETDASLSTLLTETKKSSGEITHTLSCLSLSEAASMSGDDNLEDDYLL