GENSCAN 1.0	Date run: 14-Jan-104	Time: 20:04:22

Sequence STX12_1 : 53431 bp : 41.57% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1153   1492  340  0  1   77   52   286 0.327  18.02
tgcatccccaagcctcggggagtcctgtctctaagctacagtcccagctccagtcccagc
tccagtcccagcggcgcctgcgcactttggaccggggcggggaggacgcgtgcgcgccgc
gtgagggcggggctagtgcgcacgcagccttagctccttccccgcccttgctcttcccag
TTTCTCCGTCAGCCTGCGGGTCCCGGCTGGCGGCTGCTTCCGGTAGGAGAGCGGTGTAGA
GCGAGCAGGTCTCAGCTCCTCGTCATGTCATACGGTCCCTTAGACATGTACCGGAACCCG
GGGCCCTCGGGGCCCCAGCTCCGGGACTTCAGCAGCATCATCCAGACGTGCAGCGGCAAC
ATCCAGCGGATCAGCCAAGCCAGTGAGCCGGGGTACCGAGCTGGGGGGCGGGAGCTGTCC
CGGGGACAGGCCTGGGTGAGGCTGCCGGGACGCAGGGCCCGGCTGGGGCTACGGCCGAGG
CCACACCTGGGGCTGTCTCGGGCTGTCCACCCTGGGGGCG
gtgggctgccatcccccaatctgtcaggcccgggttgcccgagggtccccggccccagct
gaagcttgagctgcttctctggagttctgcccccacggtgctgggaccaaaacagccgac
ttgacagcccgagggtgggaaggggagtgtgtgtcacctcgagagctgtgagtgcgttga

 1.02 Intr +  17491  17560   70  2  1  109   65    35 0.521   0.62
accttgtaattagtttttggaggaatgtgtgtgtcaaggttttgatcatagcatggtctc
tattagttgcatgtattaatacttattctgaatgggaagagaccaggaatcttagaagta
gggtactcatgatgaatgtatttttcttttaaataaatctttttcttcctatctccccag
CTGCTCAGATAAAGAATTTGATGAGCCAGCTAGGAACTAAGCAGGACTCAAGCAAGCTAC
AGGAAAATCT
gtgagtaacttcctgacaaggttgggttttgtgagggccatttgaggacacagtgtcctt
gccagacagcagcttaggtttcaggtctgggaagtcagaatgagaggcagtgggtcatga
gataagagctggatctaaaagaggggcggggcaacaaagtatattaatggattgtaattt

 1.03 Intr +  18369  18477  109  0  1   78   39    70 0.372   0.47
ctttaaggtggtgcggacccaaagagtgagcagcagcaagatttactgtgaagagcaaaa
caacaaagcttccacagcgtggaagaggatctgagcaggttgctgctgctggctggcgtg
gccagcttttattcccttatttgtccccacccatgtcctgctgattggtccattttacag
AGCACTGATTGGTCCATTTTACAAACCTCTAGCTAGCCACAGATTGCTGATTGGTGCATT
TTACAATCCTAGCTACAGAGTGCTGATTGGTGCATTTTACAATCCTCCT
gtgagacagaaaatttctcagagtcctcacccaacccagaagtccagctggcttcacctc
taagtattaagtaatgtaatctagagatgatttaaagtatatggaagggggtgctgggtg
cagtgactcatgcctgtaatcccagcactttgggaggctgaggcgggcagatcacctgag

 1.04 Intr +  20870  20923   54  1  0  101   91    32 0.602   3.06
atagcatgtggtttcactgtcgtctcagaaagcctttgtagaaatggctggatagtagag
gaaaccacaaatgaaaagagtactttttgtatttctactactttaagttccacttaatat
actacatattctttcctcttcaattccccttcctccctactccttttgtatttttaacag
GTAAGGCTTCTTTGTTTTGGAGGGAAGAGCCAGAAACTCAGGTATAAAGAGCAG
gtaggaagccaaggataaggctagaaaagagccagctttttaaagcaagagcatgggatt
agatgtttggaggttgttccctagggtaggtaggaagctacgcttttaatgcacatttca
tctaactgtctgtgcctagattctagtcagtggactgtggcagtcaactcctggacaata

 1.05 Intr +  29607  29744  138  2  0   67   84   129 0.737  10.14
agtattaaccagggacttgagctagcaaagagcaaatttattaatttaaagaagagacta
tttcataataattttcctagttggaaatctttaaggggtataattttacttttaagggaa
attaaaaccaaatgattctgggttaatatgaaatctcaagttcttgcttgatttccttag
CGCCAGCAGAGACTTCAGAAGGAACGCCTCATGAATGACTTCTCTGCAGCCTTAAACAAT
TTCCAGGCTGTGCAGAGAAGGGTATCTGAAAAGGAAAAGGAGAGTATTGCCAGAGCAAGA
GCTGGATCTCGTCTTTCT
gtaagttgattcccaaaagaagacctttgcaatatcagaatgttcttttccaagtttgtg
ggtttttttctttttctctttgaccaataaacatgtaagttagctgctgtgaaaatggca
ggttggtgtaacctatgtaaaaaacatatatgcatgtgatcaaagcctagaaaggaatct

 1.06 Intr +  38175  38218   44  2  2   64   90    11 0.327  -4.98
cttcaaccactttacacccacttcttagttgagacagattgccagagtcctatgtaatct
tacagattctgtgggtgtcaaaggatgttgcttctttatactgtgctaaggaagcccttg
ttttgtgtgtctgtgatgtgtttctggatgacagcagcaataataccatctactttctag
GCAGAAGAGAGGCAAAGAGAGGAGCAGCTGGTCTCATTTGACAG
gtaatagaattattcatacaacctgctggatagttgagatgggaatctatctcgttatat
tttaattttaaaaatcaatgaaaaaatagagggcaaaaataagggggcacctggagtgga
taacataatccacagaataaaattaaaaaggcaaaaccatgggcttttccaagctctttg

 1.07 Intr +  40092  40197  106  0  1   83   78   175 0.804  15.30
tatcatcagctctttgcttctggatatgaagaatgtggccctccaagactttattgatag
cagaggactggagccctggtaatgtctttgcataggttctgctggcagtagagatgttgg
agatatgtcttgttatgcctttgagaggagaaatcacctagtgtgcctgtttccctgcag
CCATGAGGAGTGGAACCAGATGCAGAGCCAGGAGGATGAGGTGGCCATCACTGAGCAGGA
TTTGGAACTTATTAAAGAAAGAGAAACGGCAATTCGGCAGCTGGAG
gtgagagccacgtcatgttttttgtttgactcagtgtgtctgcaggtatctgaactcctt
agttcactttaattctcttagtgattatgaaaaggcataaaatgtgtcattgtgtgattt
gtattttttctgtctcagtgtaatcatggtgggtttgaactaccggttttttttgttttt

 1.08 Intr +  45780  45852   73  2  1  121   76    76 0.991   7.76
gtgccttctgttttacaatattgggtaggcagcaatagattattttctgtttatggagaa
agcatgctttgtagagccttaaaaacacacgtgttaatagctaaaactttaggtacgtga
gggaaacaaatcttctaacatgttgcttaatgttagttaattgttttttgtcttccttag
GCTGACATTTTGGATGTCAATCAGATATTTAAAGATTTGGCCATGATGATCCATGACCAG
GGTGATCTGATTG
gtatgtattattgatacctttaacctcaaggtgagttgatagtatttggcatgcatctgt
aatcccagctactcagaaggctgaggctgaagcaccatctaggagtttgaagccaacctg
ggcaacataatgagaatttgtctcttaaaaaagaaagaaagaaagaaaaaggagttaggc

 1.09 Intr +  47579  47661   83  0  2  129   98   134 0.545  16.94
attcattgttttttctccaaagaaaaggctagtctcttaccaaggtagtaactcgatttc
atggctggatagtttggatagtggtagtgaaaccaggacatgtaacatcagaaatctgtt
caatttgcagtcttaaaacatctgagtgtgttaaaacatcctctgtccttccttttgcag
ATAGCATAGAAGCCAATGTGGAAAGCTCAGAGGTGCACGTCGAAAGAGCCACTGAACAGT
TACAGCGAGCTGCTTACTATCAG
gtaaaagcgggtaccaaagaaagtcactctgtgttgcagactttttaggccatcagagta
cattgacatattgagaacagctacagcctttgcttaggtttaagctaaaggaaagtagtc
ataattgcagtcccagttccatttttattattttcctttgcagatagatctacaaaaaat

Predicted peptide sequence(s):


>STX12_1|GENSCAN_predicted_peptide_1|339_aa
FLRQPAGPGWRLLPVGERCRASRSQLLVMSYGPLDMYRNPGPSGPQLRDFSSIIQTCSGN
IQRISQASEPGYRAGGRELSRGQAWVRLPGRRARLGLRPRPHLGLSRAVHPGGAAQIKNL
MSQLGTKQDSSKLQENLALIGPFYKPLASHRLLIGAFYNPSYRVLIGAFYNPPVRLLCFG
GKSQKLRYKEQRQQRLQKERLMNDFSAALNNFQAVQRRVSEKEKESIARARAGSRLSAEE
RQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLELIKERETAIRQLEADILDVNQIFKDL
AMMIHDQGDLIDSIEANVESSEVHVERATEQLQRAAYYQ