GENSCAN 1.0	Date run: 14-Jan-104	Time: 20:39:20

Sequence SSR2_1 : 14287 bp : 47.01% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1172   1249   78  1  0    5  127    57 0.255   1.05
aaaaatcagcttgaaaagccccccaaagagggccgaataagaagcctggagaacgcacaa
acctcttaggagcgctcacagcctctcaggcaggcgggcactacaaagggaaaggtgggg
cttctccaagaactacaactcccacaaggcattgggcggaacaccacggtttccggccag
TGCTTATTTCCGGTCTTTCGGATGCTGACGCTCTCTTCCTGTCTTTGTGGCTCCGGAAAG
GCGTTTGGGATGCCAACG
gtaagtccggaggcttagggcgtccgaacgggagaggcgagagcctcgtgtccgcgcatc
accccgtggctgggggttagctaggggagggcgggaagggcagaggacgcggtggctgga
ggacgtgtaaccttgcaagaggcgggaggcggggggcagaggtgattgacccccgccccc

 1.02 Intr +   1970   2124  155  1  2  101   88   135 0.961  13.67
gggtgaagatggtaggagagtctggagaacgggtctgctctggtggcttatggactactc
tgtggaaggggctgctgttctggtagcatcgaaggagctttctacgggagcgctgtcaag
aggattttggtgaatttgacgtacttggtttgataactcactttgcttttttctctaaag
ATGAGGCTGCTGTCATTTGTGGTGTTGGCTCTATTTGCTGTCACTCAAGCAGAGGAAGGA
GCCAGGCTTTTGGCTTCCAAATCACTGCTGAACAGATACGCCGTGGAGGGACGAGACCTG
ACCTTGCAGTACAACATCTACAATGTTGGCTCAAG
gtaactcgaggccctagagttacagattaagcctatttctggattcttagttttcagatg
ggaatagggagcatattggtgggtagtggtttctctttgggacacttccagcatcagata
tattgagtgaatgaatacacttcgggatctacttttggaaaggaggacattcttacctaa

 1.03 Term +   3769   3889  121  1  1   95   45   128 0.999   7.15
tttagtagagacagggtttcaccatgttggccaggctggtctcgaactcctgacctcagg
tgatctgcccacctcggcctcccaaaagtgctgggattacaggcgtgagccacggcgccc
ggcctgctttaattttatatccattacttactaaccctttttgtttcatccattttctag
TGCTGCATTAGACGTGGAACTATCTGATGATTCCTTCCCTCCAGAAGACTTTGGCATTGT
GTCTGGAATGCTCAATGTCAAATGGGACCGGATTGCCCCGTATCCTCTTGGCACTTGGTG
A
tgaagggtcggggggcagggagagccttgcctgcaaagcagcaggggtacttcaaatagg
ctggatatgtgtggctgtcctcctgtcatctctctggataagatggagcaagagaggttg
gtgtaaattgtgtgagcatgatttagagtagacatgaagaaggaggatactgaagttcag

 2.01 Init +   6904   6984   81  0  0  114   78    65 0.995   9.07
tgcctcagcctcccgagtagctgggactgcaggcgcatgctgccatgcccagctaatttt
ttcgtattttattagagacggggtttcaccgtgttgcccaggctgttctcgaactcctga
actcagccaatccacccgcctcggcctcccaaagtgctaggattacaggcgtgagccacc
ATGCCCGGCAAAGAAGCCTATATTTTTTCATTCCTGCAGAATATTGCCGGCATGAGATCA
GCATGTATTGGCAAATGTTTT
gtaagtggtgcatttagtccacaggttgaaaggctgctacaactttagcttcatctcttt
ccgttccttaactcttgagccagtgctagcaatgtctcccacactgtggtcctgcgccct
ctcaaggctggttatttcaacttcacctcggcaacaattacttacctggcccaggaggat

 2.02 Intr +   7111   7176   66  0  0   53   89    59 0.749   1.60
tcattcctgcagaatattgccggcatgagatcagcatgtattggcaaatgttttgtaagt
ggtgcatttagtccacaggttgaaaggctgctacaactttagcttcatctctttccgttc
cttaactcttgagccagtgctagcaatgtctcccacactgtggtcctgcgccctctcaag
GCTGGTTATTTCAACTTCACCTCGGCAACAATTACTTACCTGGCCCAGGAGGATGGGCCC
GTTGTG
gtgagttgcccaaacccttagctggatggaatttggatctgccttcccttaaaatctctt
gtggtgggggtaagagggggatgaagagaggttgattaatagataccaaaatacagttag
gactgggcgcagtggctcacacctgtaatctagcatttttggaggccgaggtgggcagat

 2.03 Intr +  10250  10327   78  1  0  123   52     4 0.438   0.05
atcatccaactctctctagccaaaagctttccctcatcttcttgaagttcttctgagcct
ttgggaactaagactctaatgcatagagttgggttggttgggactgccctttctcagagt
agatgaggtggaacttcatgaggtggacttcccttaatgtcgttcttttcttcttttcag
ATTGGCTCTACCAGTGCACCTGGACAGGGAGGAATCCTGGCTCAGCGGGAGTTTGACAGG
CGATTCTCCCCTCATTTT
gtaagctttctagtgttctctctcatcagttccttggtatgagaatgcccttttggttct
ggaccctcttggcttccacagatttgttttgttggttggttcttgccctgtgtgtttttt
ggtgtctgatatagatactcatcaaatagattgatttagccatgtccagagatttttggc

 2.04 Term +  12487  12597  111  0  0  100   38   103 0.956   5.06
ctgcataccagcctaggtgacagggcgagactccgtctcaaaaaaaaaaactaagacttt
gtatcaaaaataaataaatttgggctagactgctccctttctcattggactcatattttc
cctggcttctcctgtgccctaatccagacttctaagcaaggtctttgttttcctttacag
CTGGACTGGGCAGCCTTTGGGGTCATGACCCTTCCCTCCATCGGCATCCCCCTGCTATTG
TGGTACTCCAGCAAGAGGAAATATGACACTCCCAAAACGAAGAAGAACTGA
ttggggcttccacagccctcctctcccaagaaatccaggctcctctcccaagaaatccag
gtgctttccagactccaaagggtatcttaaatgcaatctcttctctcttagcccttggcc
actttctcctggatcctgccctgctctcagccatagtgaaggaccagccctaggagtctg

Predicted peptide sequence(s):


>SSR2_1|GENSCAN_predicted_peptide_1|117_aa
CLFPVFRMLTLSSCLCGSGKAFGMPTMRLLSFVVLALFAVTQAEEGARLLASKSLLNRYA
VEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPYPLGTW

>SSR2_1|GENSCAN_predicted_peptide_2|111_aa
MPGKEAYIFSFLQNIAGMRSACIGKCFAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGG
ILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKTKKN