GENSCAN 1.0	Date run: 14-Jan-104	Time: 17:21:07

Sequence SORT1_1 : 86550 bp : 42.35% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1260   1565  306  2  0  101   99   330 0.950  30.74
gacgcgagccaatgaggagtgggccggggaagagggacaggcggccagcctatggggcgg
agaggcccggccgcgcgtatccaaggagcgccgcgctcggctcgggggtgtggcgcgcgc
cggcgggggtgggcgggcgcgccgggcggcaggtgtcggcgtcggcggcattcggcggcg
ATGGAGCGGCCCTGGGGAGCTGCGGACGGCCTCTCGCGCTGGCCCCATGGCCTCGGCCTC
CTCCTCCTCCTGCAGCTGCTGCCGCCGTCGACCCTCAGCCAGGACCGGCTGGACGCGCCG
CCGCCGCCCGCTGCGCCGCTGCCGCGCTGGTCTGGCCCCATCGGGGTGAGCTGGGGGCTG
CGGGCGGCCGCAGCCGGGGGCGCGTTTCCCCGCGGCGGCCGTTGGCGTCGCAGCGCGCCG
GGCGAGGACGAGGAGTGCGGCCGGGTCCGGGACTTCGTCGCCAAGCTGGCCAACAACACG
CACCAG
gtgagcgggcgccgggcccgggagccgctcgggtgcgaggtgccgcccgcgtgcccctcc
cggcccgtgcgccccgcgactcccggaggagaccccagccctgccgcgcccgcgtccccc
gggccgcagccccgaaactgcggcgggcgggcgggcggagtcgggcccgggcggccggcg

 1.02 Intr +  29563  29622   60  0  0  109   98    30 0.050   4.11
tgtgattcacattaagtagttaaatcccatccctcccaaattttgtactgggaatccata
cccactttgtaattatgaacttaattactctgaacagtaataaagttcagatatttaaag
aagccaaagattgaaggagagtggctgtcatttctaaattaattttttttccccttatag
CATGTGTTTGATGATCTCAGAGGCTCAGTATCCTTGTCCTGGGTTGGAGATAGCACTGGG

gtaagtcatattttgagtctgttatttcagcccagcaagaagatgataacagatttgggg
aagggttaagcacctaatatcatttcttcctgaaactgtctttagcctcaatcacagaaa
acacatgtttgcaagacagactttcaggaagttgtagttgtgttggttttgctttagaat

 1.03 Intr +  31671  31744   74  2  2   96  100    17 0.048   0.99
aaatgagctgaggactttctcatcattctcagccctagtaactagatccttctagacttt
ggggagtactacaaagtagggatatcaaaagtcttttaggtgttggcttaatctcgaaca
catatcagcatgtgattggaatatcttttttatttacggaatgcttttttctctctccag
GTCATTCTAGTCTTGACTACCTTCCATGTACCACTGGTAATTATGACTTTTGGACAGTCC
AAGCTATATCGAAG
gtgagatcaataacacgcgttggagcatttcactaagtaacattgagaatatagattctc
ccttttctagacatgatggcacgtaacagttgatgtaaaagatcttctagccatcctaag
ttttcaccagactgtcacactcagcacatgtttttgttgttgttgttgttgttgtttttt

 1.04 Intr +  43683  43785  103  0  1  102  100   106 0.999  12.46
ggggcgggtggaatgttcttcggactcaccagggcacctctggagctaggaatgtggcta
ttcagggtgagccgagtctctcagcatgattggtggaaagggagaatgaaagctgagtag
gaactcagtaatatccatgaccactgcaccctaaatttgccctttttttcttcctctcag
TGAGGATTATGGGAAGAACTTTAAGGATATTACAGATCTCATCAATAACACCTTTATTCG
GACTGAATTTGGCATGGCTATTGGTCCTGAGAACTCTGGAAAG
gtgagactcattcttgtatacataaagcttgtgcttgataccacatgcagagctgtcaga
tattagtattggcatggtccagtgattcacagtaatgtattttagtttagtattgctata
tttatattttaaaattaaacacaattttttaagggtctcactctgtctcccaggctggag

 1.05 Intr +  44621  44785  165  1  0  107  100   122 0.983  14.54
ttatttttttataagaataagacccaaggggtagagtggaacaactaatcagtttttata
actcttcttatttctagaactaaaatttcttaactaatgtctggtgaaaatggtgtaaga
actcctgtgcttgcatagatagtatcataccctgaatcagatctttcctcttcctatcag
GTGGTGTTAACAGCAGAGGTGTCTGGAGGAAGTCGTGGAGGAAGAATCTTTAGATCATCA
GATTTTGCGAAGAATTTTGTGCAAACAGATCTCCCTTTTCATCCTCTCACTCAGATGATG
TATAGCCCTCAGAATTCTGATTATCTTTTAGCTCTCAGCACTGAA
gtaagtccagttgaggaacatggtttgccttttgcattttatagtctcaaatgtactgtc
ttagaaggatcctttaggaaatgcttttaatattggacttctttcaagtctccttatggc
atgaagtatgtatttttttgacgttttttcctatttggtaaaggacacgatttccacatg

 1.06 Intr +  47345  47508  164  1  2   80   39    93 0.413   1.45
acacacacacacacacacacacccctacctctcatcctgccctgcaggagaagtcatccc
gttctactatgctagcttctaaattcttgcagagcctgttcctcatggccagtgttcaag
acctcattagctcttaccgaactaatgtggcagtcattccctgcttttccttgcctctag
TCTGGACCCTCTGAAATCCATCTTTCCCATTCACGTCCAAGTACTCCACCTAAGAAAGTG
AAACGGACTGTGTCATCCTCCTGCTTAGCACACATTCCTCCTGAGAGCACCTCATATGCA
ATAAACCCTGGAGTCCTTACCATGGCACAGAAGGAAGGCTCTCT
gtgagctggcctcacctttctgcctagcgttagttcctcatttgcttaccttggaatttg
cactcaggtaatgcctgatggcttttagctccctgcacacactgcagggtttatgacctc
cttgcgtttgctaatactagtctctctttgtgcagcaacacctcatctccctgtttgcct

 1.07 Intr +  51620  51669   50  2  2   86   92    32 0.362   0.81
ggcagtggggagcttgacaggcagagctgtgaaggaccagggctcagcgcctgagaagtg
gtgcttgtcagtgcctgtgaatgaagcttgttagacctgctaggaagtttgtgagtaagg
tcaacacagtccttcagcagtcttaaaccatttcttttccctgtttttgcctcattgtag
GGGATCAGACAACACCATCTTCTTTACAACCTATGCAAATGGCTCCTGCA
gtaagtatattttagtcccagaaaataatgtcctgttgtccattcatggtagaattttct
gggttgtgcaaggtagaaacataaaaggtccctccattctcctgaaattgtaatagctaa
agaaagctgttagtggttattaaaatcttgaaagtaaaaccaaattactacactacccag

 1.08 Intr +  53271  53401  131  1  2   56  100    58 0.377   3.29
gggattacaggcatgagccactgcgcctggccgctgtatcacattttatgttgtcacttg
attaacatgcatagtatttaaaatgctttagctataaaattaagattgattctaaaacaa
ctgctttgaactaggctcaccagtaagtgaaattttaattaatattttgtcttgtttaag
AAGCTGACCTTGGGGCTCTGGAATTATGGAGAACTTCAGACTTGGGAAAAAGCTTCAAAA
CTATTGGTGTGAAAATCTACTCATTTGGTCTTGGGGGACGTTTCCTTTTTGCCTCTGTGA
TGGCTGATAAG
gtaggtattgccctctcccctttggggtctgatatttctgcaaatatctctcgtatagat
tctctttattacttggcattgacagagtttcttgtctttttgttatatttagtaccactg
tgagtgttaggggtgattctttttgcaaaggctgattgactgataggctactctgcactt

 1.09 Intr +  56994  57138  145  2  1   29   94   115 0.389   5.13
ctagaactttgctaggggctagaaattgctttggtaattggtactatgacctttcattca
tagcaatcgtacccagtagagaaatggataatagtagttatttaaaacattcttgttcat
gtccctgcccatggcatcttggcagaaaattagaaagataaatattgacatctgttctag
GATACAACAAGAAGGATCCACGTTTCAACAGATCAAGGGGACACATGGAGCATGGCCCAG
CTCCCCTCCGTGGGACAGGAACAGTTCTATTCTATTCTGGCAGCAAATGATGACATGGTA
TTCATGCATGTAGATGAACCTGGAG
gtaagagctttttagtggcttacccttaaaagcatagagatgtaagctttgagcagcttt
tatttttacatgtcgagttttcctcttacccctagaaatttattagtgccctactgattt
ttctgtcctagagatcatctgtagcccctgttaaaaatgccacttgttttggtagcttgt

 1.10 Intr +  58273  58428  156  2  0   68  113   132 0.899  12.76
gatgggcataaagatcttgagtatcaaaccttgattaattctcaggtctgagtcttcatc
atgaagagacacaattggctactgtgtttggtcaggcaggtaatcgtgtgtggttagact
attgtttttctctttggttccacccaagacttagtatttttgtttgtttgcctatttcag
ACACTGGGTTTGGCACAATCTTTACCTCAGATGATCGAGGCATTGTCTATTCCAAGTCTT
TGGACCGACATCTCTACACTACCACAGGCGGAGAGACGGACTTTACCAACGTGACCTCCC
TCCGCGGCGTCTACATAACAAGCGTGCTCTCCGAAG
gtgagtctcggcatcgcagtggtgtactgtgccttcagctgcatgtggtaggatttgagg
cttcggggaacctgtcccctagtaatgttgcttgccaagccaacaagcctacccatgtac
atttttttgtttccttttttttttttattgtggcaatatgtctaacaaaatttgcagttt

 1.11 Intr +  62806  62912  107  2  2  111   68    88 0.991   8.11
ctcaaatatcatatttaaagtgctgctccgttaccaacaatgagccgttttgtgaggtgt
tacaagcttgtcggactccaggtgctatacggtctcaggagagagtcatgcagtgataaa
gtgaatctaacctaggtacttccagtgtatcagacttaatgttgttctcttcccattcag
ATAATTCTATCCAGACCATGATCACTTTTGACCAAGGAGGAAGGTGGACGCACCTGAGGA
AGCCTGAAAACAGTGAATGTGATGCTACAGCAAAAAACAAGAATGAG
gtttgtttactctaatgtgtgcagagcacagcagcctttccattgtgctctgatcagtgc
cagccttttggatgatgaagtttcatacttgattagggtcctcagcataaggtggaaagt
ttggagatgagagtaatgaaattaacttagaatttcggaagtaagaactgaggaaaggtc

 1.12 Intr +  71551  71653  103  0  1   87   91   116 0.538  10.63
caatgtgaatatacttaacactactgaactatacacctaaatagtaaataaatagttaag
atagtacttttacctaggtctgggttaacttaaagctttattggaagggttttgtgaaat
gattaaagaaattgtatctttatctttggttctaatctacgcttttgtttcttttcacag
TGCAGCCTTCATATTCATGCTTCCTACAGCATCTCCCAGAAACTGAATGTTCCAATGGCC
CCACTCTCAGAGCCGAATGCCGTAGGCATTGTCATTGCTCATG
gtaaggaacctcccactcaccacctccaactggaacagtggctgagcacactgaaactca
gccaacaggctttgaacgctctgagaagaaacaatgtggatgcttttacattcctttggt
agaatttcttacattataacaacactttgggtttttcatcaacttttatcagagagagca

 1.13 Intr +  71992  72160  169  2  1   62   18   217 0.996  10.18
tcaacttttatcagagagagcaacacaacttctccgaagtttttggtggttttctttcct
actaaaagaggcttgatgggaaataatcagaataaattcattcaacattattctctctgg
agtaaatgctctctgtttcattgcctatttgtgctaatgagatggtggattatattgcag
GTAGCGTGGGGGATGCCATCTCAGTGATGGTTCCAGATGTGTACATCTCAGATGATGGGG
GTTACTCCTGGACAAAGATGCTGGAAGGACCCCACTATTACACCATCCTGGATTCTGGAG
GCATCATTGTGGCCATTGAGCACAGCAGCCGTCCTATCAATGTGATTAA
gtatgcatgaactcatctcacacacactgtctgcatagagggcaactgggggaatgttct
tcagtttattggggggatgttacagactataattcaaatttttgcatttgacagaactat
agataagattctagaaaggattgcttttaattggcaactcagattaaatggcattgtttt

 1.14 Intr +  74063  74253  191  2  2   98   74   142 0.999  12.11
gagactccatctcagaaaaaaaaaaaaaaaaaaaaaaagttaaaataattgtcagccaat
aagccaccacctaaatgtaaggggttttgtctggtttgggatcaaaaagccagagtggtt
ttctgaattcccagtacacattgatcctctgtcatgatctttctgtaattgtggtttcag
GTTCTCCACAGACGAAGGTCAATGCTGGCAAACCTACACGTTCACCAGGGACCCCATCTA
TTTCACTGGCCTAGCTTCAGAACCTGGAGCTAGGTCCATGAATATCAGCATTTGGGGCTT
CACAGAATCTTTCCTGACCAGCCAGTGGGTCTCCTACACCATTGATTTTAAAGATATCCT
TGAAAGGAACT
gtgagtgtctcctttgaccttttctaccagaaacttccaagtccattttcctaaataatc
aatatggtttaatttcttttagctggaatcagcagatgcatatgcatatgaaagaggatt
gacagatgttctgtgtgggtgattaagtaatggaatggcatcagaaaaacaacctcctcc

 1.15 Intr +  75962  76318  357  0  0  110   49   279 0.444  20.50
caaatagggtttttcctaatcctcagatggatgttgagatggaaggaatactcttttggc
atgaggaaatgcgattgctagtaggctctagactagtgtaactttttgtttgcaattcca
aaatgaaggaataggttgagtcagacattcccactttccctctccttgttcttcctatag
CCTGGCAGCTGCCTCCCGTGGGTGGGTTCTGTGCTGTGTACTTTCCTGAACAGTGTGTCT
CTCCTTTAGGTGAAGAGAAGGACTATACCATATGGCTGGCACACTCCACAGACCCTGAAG
ATTATGAAGATGGCTGCATTTTGGGCTACAAAGAACAGTTTCTGCGGCTACGCAAGTCAT
CCGTGTGTCAGAATGGTCGAGACTATGTTGTGACCAAGCAGCCCTCCATCTGCCTCTGTT
CCCTGGAGGACTTTCTCTGGTATCAGCATTCCTCAGATTTCTCTGTCTCCCTTTCCCTGT
TGGAGGAGGTGAAAGACAGTTTTCTTATAGGGCTAACAAATATTGAAATCCAGCCGG
gtgcggtggctcacacctgtaatcccagcactttgggatgccaaggcaggcagatcactt
gaggccgggagttcgagaccagcctggtcaacatggtgaaaccctatctctacaaaaaac
aaacaaacaaaaaaaaattagcagggcatggtggcgcacgcctataatcccaagctgctc

 1.16 Intr +  81146  81299  154  0  1   48   68   214 0.551  13.61
gtgggactccatctcaaaaaaaaaaaaaaaaggccctctccgtgtctgttttcctaaatc
gacctccttcagaggtgtcacaggacttcctgagctactttctaacaacccaagactgga
atgttaaccatccactaccccacataacccttcattgctagtcacttaacggtcttccag
CTGCTTTGAAAGGTACTTTATTTGCTGACTCTTGCAGTGATTTTGGCTACTACCGTCCAG
AAAATGACTCCAAGTGTGTGGAACAGCCAGAACTGAAGGGCCACGACCTGGAGTTTTGTC
TGTACGGAAGAGAAGAACACCTAACAACAAATGG
gtgaggtggccttttctcccttgtcacgatggatgaggtgttcttgttcagagtgaaagc
tgcttctctccacactgagatccaagccctactttagagcactatttttggcggggttgg
ggaggggcaggatatgaaggcctccttcaagggtcaactacaggaggtgagccatgagtg

 1.17 Intr +  82194  82302  109  0  1   73   91    96 0.996   7.77
aggcctgaaactacacaaaatatcccccaaaacatccctgtggacattccccccaggcct
gaaacatgacgtaaggatgggaagcttttcggcagcttttcaaatcttgtttccaagaaa
taggcaggtacccaggaatacatccttatcttctgttaccaaatcttctttgcctggtag
GTACCGGAAAATTCCAGGGGACAAATGCCAGGGTGGGGTAAATCCAGTTCGAGAAGTAAA
AGACTTGAAAAAGAAATGCACAAGCAACTTTTTGAGTCCGGAAAAACAG
gtatgttaaaataggtctagttttcaggtacaaatgggattttgtgttctgctaagaaaa
atcaaagttaaagcatcaagagttttgttactgataaaaagtggtcaaactacttctctc
aggcttcccttatacaggaagctgttagcatgaaggatgggtcatgtaacccagtgataa

 1.18 Intr +  84374  84480  107  1  2   49  116   115 0.999   8.49
ataatattctcctggtaacactgagatggttcatcttggggggttggaaaagagccatca
ttaagcgcatcaggactgcagatcattcacaaagagatgaggggaatgagtggctgcctt
gacctcagtcctaggatatgcatgcctaaaacttttgtgtttgtgttttaatttctcaag
AATTCCAAGTCAAATTCTGTTCCAATTATCCTGGCCATCGTGGGATTGATGCTGGTCACA
GTCGTAGCAGGAGTGCTCATTGTGAAGAAATATGTCTGTGGGGGAAG
gtaaggaacacagaagtcaatccaaggtactgagttcaagccagaaggctgatctagggc
atatggctgagtctactcttggcaaaaactaggtacttgcagtactgttcctgaaaaatc
aggcccaaatcttctcatgtcgtacatttttcatatgtcaaccatggactgtgctttctg

 1.19 Intr +  84768  84891  124  0  1   43   78   167 0.834  10.87
ttcctgaaaaatcaggcccaaatcttctcatgtcgtacatttttcatatgtcaaccatgg
actgtgctttctgtgtctgtgatgcgttcctgagtgtataaaactgagaaagtccacagt
cctgtaagaagtgcacccctgctgtgtaccaccgagtgttaaggaggtttctgttcacag
GTTCCTGGTGCATCGATACTCTGTGCTGCAGCAGCATGCAGAGGCCAATGGTGTGGATGG
TGTGGATGCTTTGGACACAGCCTCCCACACTAATAAAAGTGGTTATCATGATGACTCAGA
TGAG
gtgaggctatttcttcttgaatggtagtacccccccccccaaaaaatacaagaaaataaa
gtctgtcttctattcatgatcaagatatgccagggccaaggcgacttaatgaccataaga
tttggcaagcccagaaactaggtgattgcttttgaaataggagtgttgtggtctgtcggt

Predicted peptide sequence(s):


>SORT1_1|GENSCAN_predicted_peptide_1|925_aa
MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGL
RAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDS
TGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSG
KVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTESGPS
EIHLSHSRPSTPPKKVKRTVSSSCLAHIPPESTSYAINPGVLTMAQKEGSLGSDNTIFFT
TYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVS
TDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSL
DRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDA
TAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDD
GGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFT
GLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNSWQLPPVGGFCAVYFPEQC
VSPLGEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICL
CSLEDFLWYQHSSDFSVSLSLLEEVKDSFLIGLTNIEIQPAALKGTLFADSCSDFGYYRP
ENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTS
NFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEAN
GVDGVDALDTASHTNKSGYHDDSDE