GENSCAN 1.0	Date run: 14-Jan-104	Time: 20:28:52

Sequence SLC27A3_1 : 7264 bp : 58.56% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1266   2073  808  2  1   65  110   796 0.903  74.85
aggcgcgagcaccgcccaggacctggtagggtgcgagccgcgagcagtccgggagggagc
gcgcctagggcggagcgtaggctgtggggggagggctgggagtccggggccgccccacac
ccgcactcctcccgggtttctgctctccgcccgtgtggagtggtgggggcctgggtggga
ATGGGCGTGTGCCAGCGCACGCGCGCTCCCTGGAAGGAGAAGTCTCAGCTAGAACGAGCG
GCCCTAGGTTTTCGGAAGGGAGGATCAGGGATGTTTGCGAGCGGCTGGAACCAGACGGTG
CCGATAGAGGAAGCGGGCTCCATGGCTGCCCTCCTGCTGCTGCCCCTGCTGCTGTTGCTA
CCGCTGCTGCTGCTGAAGCTACACCTCTGGCCGCAGTTGCGCTGGCTTCCGGCGGACTTG
GCCTTTGCGGTGCGAGCTCTGTGCTGCAAAAGGGCTCTTCGAGCTCGCGCCCTGGCCGCG
GCTGCCGCCGACCCGGAAGGTCCCGAGGGGGGCTGCAGCCTGGCCTGGCGCCTCGCGGAA
CTGGCCCAGCAGCGCGCCGCGCACACCTTTCTCATTCACGGCTCGCGGCGCTTTAGCTAC
TCAGAGGCGGAGCGCGAGAGTAACAGGGCTGCACGCGCCTTCCTACGTGCGCTAGGCTGG
GACTGGGGACCCGACGGCGGCGACAGCGGCGAGGGGAGCGCTGGAGAAGGCGAGCGGGCA
GCGCCGGGAGCCGGAGATGCAGCGGCCGGAAGCGGCGCGGAGTTTGCCGGAGGGGACGGT
GCCGCCAGAGGTGGAGGAGCCGCCGCCCCTCTGTCACCTGGAGCAACTGTGGCGCTGCTC
CTCCCCGCTGGCCCAGAGTTTCTGTGGCTCTGGTTCGGGCTGGCCAAGGCCGGCCTGCGC
ACTGCCTTTGTGCCCACCGCCCTGCGCCGGGGCCCCCTGCTGCACTGCCTCCGCAGCTGC
GGCGCGCGCGCGCTGGTGCTGGCGCCAG
gtaaggctggagctccgaactgactaaggcggggccagccacagaagggggcgtgtcgga
gaccacagaaaggcttggtctcatccctgggcctgggaagaagccgactatcccttgggg
ttcgaaagtgggtggagataggagtctccgggtttgagaagggatgaggctgaatctttg

 1.02 Intr +   2427   2636  210  1  0   76   76   124 0.995  10.10
atctttggtgccccaaggatccccaaggagtcgagttccaggcctcagacccaagatgga
atgtccatacccttcaccctcatccaagagcagtgtgggctgggatagggaggggacatg
ggtcataggctcttctaggtagagccagggccccggcgttgtgctttcccacccttctag
AGTTTCTGGAGTCCCTGGAGCCGGACCTGCCCGCCCTGAGAGCCATGGGGCTCCACCTGT
GGGCTGCAGGCCCAGGAACCCACCCTGCTGGAATTAGCGATTTGCTGGCTGAAGTGTCCG
CTGAAGTGGATGGGCCAGTGCCAGGATACCTCTCTTCCCCCCAGAGCATAACAGACACGT
GCCTGTACATCTTCACCTCTGGCACCACGG
gtgagggccgggcaccatacttagctccccgaaaccaaggcagaggaaggcaggggtctg
ctcccagaccactccttcaaagcccccagagaggatgctgatttcattggcacatccttt
ttctccccatcatttcactccccagtctcctcacctcctactcatttctccacctccccc

 1.03 Intr +   2971   3129  159  2  0   92   57   167 0.999  15.15
ctcctactcatttctccacctcccccagaccacccatatttccaggacagcctggtctcg
gtcctcagcttctgtcctgcctccgcctctttctgtgggaaacccagcgggggtgcaaac
agataggtagagcttggagtttgcccttcccctgatcgtcccataactgccaccccacag
GCCTCCCCAAGGCTGCTCGGATCAGTCATCTGAAGATCCTGCAATGCCAGGGCTTCTATC
AGCTGTGTGGTGTCCACCAGGAAGATGTGATCTACCTCGCCCTCCCACTCTACCACATGT
CCGGTTCCCTGCTGGGCATCGTGGGCTGCATGGGCATTG
gtcagtctccccaaccccaccttcattaattcatccagtagacatttattaagcacgtac
tatggtgtgagtcctccagggtagataatctagaggacggatggggcagagccctactca
ccaggagctctgtacaatagggcaatgtcacctgcctagacctacagactgaggaacggt

 1.04 Intr +   3670   3794  125  2  2   76   90   193 0.998  19.78
gggacaggggccgggggaggggaaagagggccagcacggcttcctgacggtgtgactccc
acagtgggcccttcccagggaaagactacagtgatggctggggtctggaaagaggggctt
gggctccccactctgctcctaatcttacctcccttcttcccccctgcccacttctggcag
GGGCCACAGTGGTGCTGAAATCCAAGTTCTCGGCTGGTCAGTTCTGGGAAGATTGCCAGC
AGCACAGGGTGACGGTGTTCCAGTACATTGGGGAGCTGTGCCGATACCTTGTCAACCAGC
CCCCG
gtgcgtgggcacagatcctgggcagagctgctgacacagggctagctcacggggagcagg
acagttgacaggagacagggagttggagggagaagcagcaagaagaaaatggcagtgtaa
gataaggagccagagatggcctaggccatctgatgcttacggcctctgaaggaggtcaca

 1.05 Intr +   4070   4264  195  1  0   67  100   254 0.996  25.32
cagcaagaagaaaatggcagtgtaagataaggagccagagatggcctaggccatctgatg
cttacggcctctgaaggaggtcacagtaggagggggttctggggaatggggaacaggaat
tcacttccgggagcgggcatcttgatgctgaagctccggcccctctcccactcatctcag
AGCAAGGCAGAACGTGGCCATAAGGTCCGGCTGGCAGTGGGCAGCGGGCTGCGCCCAGAT
ACCTGGGAGCGTTTTGTGCGGCGCTTCGGGCCCCTGCAGGTGCTGGAGACATATGGACTG
ACAGAGGGCAACGTGGCCACCATCAACTACACAGGACAGCGGGGCGCTGTGGGGCGTGCT
TCCTGGCTTTACAAG
gtgaggggcagagaggaaactgaaaacccgtggaacagcagagggctggcaggagagggg
gctcatgtgactgcaatgatccagtacccaggtctccctttccccagcatatcttcccct
tctccttgattcgctatgatgtcaccacaggagagccaattcgggacccccaggggcact

 1.06 Intr +   4372   4462   91  0  1   67   77    75 0.942   5.03
agagggcaacgtggccaccatcaactacacaggacagcggggcgctgtggggcgtgcttc
ctggctttacaaggtgaggggcagagaggaaactgaaaacccgtggaacagcagagggct
ggcaggagagggggctcatgtgactgcaatgatccagtacccaggtctccctttccccag
CATATCTTCCCCTTCTCCTTGATTCGCTATGATGTCACCACAGGAGAGCCAATTCGGGAC
CCCCAGGGGCACTGTATGGCCACATCTCCAG
gttggtggtgttctggtggggtgggcggggtgctgaagctggcacaggaggactggaatt
ggagactggggtggatgggggcagaaggctctgggaaaggtgacaccactcctgaccctg
gtgactctgccaggtgagccagggctgctggtggccccggtaagccagcagtccccattc

 1.07 Intr +   4596   4794  199  1  1   59   70   236 0.997  18.52
agagccaattcgggacccccaggggcactgtatggccacatctccaggttggtggtgttc
tggtggggtgggcggggtgctgaagctggcacaggaggactggaattggagactggggtg
gatgggggcagaaggctctgggaaaggtgacaccactcctgaccctggtgactctgccag
GTGAGCCAGGGCTGCTGGTGGCCCCGGTAAGCCAGCAGTCCCCATTCCTGGGCTATGCTG
GCGGGCCAGAGCTGGCCCAGGGGAAGTTGCTAAAGGATGTCTTCCGGCCTGGGGATGTTT
TCTTCAACACTGGGGACCTGCTGGTCTGCGATGACCAAGGTTTTCTCCGCTTCCATGATC
GTACTGGAGACACCTTCAG
gtatctgtccataactggtttttcatcctggacatctgatctctgtgatccaaagcttct
gaacctcaactctctaatctgccacctcaacctgggtcctaagctaatctctcattctca
gatctcaccatttcatccctgtgacactgacctctgacctcatctccccaccaagcccat

 1.08 Intr +   5023   5120   98  1  2  113   51   134 0.985  13.02
tccaaagcttctgaacctcaactctctaatctgccacctcaacctgggtcctaagctaat
ctctcattctcagatctcaccatttcatccctgtgacactgacctctgacctcatctccc
caccaagcccataaggccctgacccctgactcccagtttcagatctctgctctctgacag
GTGGAAGGGGGAGAATGTGGCCACAACCGAGGTGGCAGAGGTCTTCGAGGCCCTAGATTT
TCTTCAGGAGGTGAACGTCTATGGAGTCACTGTGCCAG
gtgcctaggcatggaaggtgggggaggcacccagccaccaccccgaattggtagtacttg
ggcgcagggagcacgaggccttcgtggtggtcagccatggaggggcttactctgtctccc
acacccaccagggcatgaaggcagggctggaatggcagccctagttctgcgtccccccca

 1.09 Intr +   5252   5382  131  0  2   50   91    53 0.988   3.39
gccctagattttcttcaggaggtgaacgtctatggagtcactgtgccaggtgcctaggca
tggaaggtgggggaggcacccagccaccaccccgaattggtagtacttgggcgcagggag
cacgaggccttcgtggtggtcagccatggaggggcttactctgtctcccacacccaccag
GGCATGAAGGCAGGGCTGGAATGGCAGCCCTAGTTCTGCGTCCCCCCCACGCTTTGGACC
TTATGCAGCTCTACACCCACGTGTCTGAGAACTTGCCACCTTATGCCCGGCCCCGATTCC
TCAGGCTCCAG
gtaaccggccacttcccccgccggcccctcaccccatatatcctcaccccacatatccac
cccgtgtatcaacttaggagtttgatggctcccaaactccacaaagggacccccaacgta
atacactccgtgaagagaaaaaacacggagacacaagctcttcaccccacttctttcctt

 1.10 Term +   5735   5911  177  1  0  114   54   262 0.968  24.05
ctttccttatccctgccttcttctggcctggctctttctcctccctgtcacctcctcccc
taaaccttgacctcacactccctttcccaagacttgctccttaacaaaattcaggcaact
cccctgaaccacgtgggcagagtccccttccctccaaatccctgaccctcctgtccccag
GAGTCTTTGGCCACCACAGAGACCTTCAAACAGCAGAAAGTTCGGATGGCAAATGAGGGC
TTCGACCCCAGCACCCTGTCTGACCCACTGTACGTTCTGGACCAGGCTGTAGGTGCCTAC
CTGCCCCTCACAACTGCCCGGTACAGCGCCCTCCTGGCAGGAAACCTTCGAATCTGA
gaacttccacacctgaggcacctgagagaggaactctgtggggtgggggccgttgcaggt
gtactgggctgtcagggatcttttctataccagaactgcggtcactattttgtaataaat
gtggctggagctgatccagctgtctctgacctacagtatctgtcattatctctctgtgga

Predicted peptide sequence(s):


>SLC27A3_1|GENSCAN_predicted_peptide_1|730_aa
MGVCQRTRAPWKEKSQLERAALGFRKGGSGMFASGWNQTVPIEEAGSMAALLLLPLLLLL
PLLLLKLHLWPQLRWLPADLAFAVRALCCKRALRARALAAAAADPEGPEGGCSLAWRLAE
LAQQRAAHTFLIHGSRRFSYSEAERESNRAARAFLRALGWDWGPDGGDSGEGSAGEGERA
APGAGDAAAGSGAEFAGGDGAARGGGAAAPLSPGATVALLLPAGPEFLWLWFGLAKAGLR
TAFVPTALRRGPLLHCLRSCGARALVLAPEFLESLEPDLPALRAMGLHLWAAGPGTHPAG
ISDLLAEVSAEVDGPVPGYLSSPQSITDTCLYIFTSGTTGLPKAARISHLKILQCQGFYQ
LCGVHQEDVIYLALPLYHMSGSLLGIVGCMGIGATVVLKSKFSAGQFWEDCQQHRVTVFQ
YIGELCRYLVNQPPSKAERGHKVRLAVGSGLRPDTWERFVRRFGPLQVLETYGLTEGNVA
TINYTGQRGAVGRASWLYKHIFPFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVS
QQSPFLGYAGGPELAQGKLLKDVFRPGDVFFNTGDLLVCDDQGFLRFHDRTGDTFRWKGE
NVATTEVAEVFEALDFLQEVNVYGVTVPGHEGRAGMAALVLRPPHALDLMQLYTHVSENL
PPYARPRFLRLQESLATTETFKQQKVRMANEGFDPSTLSDPLYVLDQAVGAYLPLTTARY
SALLAGNLRI