GENSCAN 1.0	Date run: 14-Jan-104	Time: 20:43:46

Sequence SH2D2A_1 : 12966 bp : 54.78% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1303   1336   34  0  1   82  115    -2 0.754   1.91
gacaatcgtcttaaggctttccatgacgtgagtcctcgccagaactaaggctgtgggtaa
ggcgacatttcctgcccccggggccagggtgagaggagagatgatgagttgctgagtgtg
cacacctttccggaacacatacacacaccctgctctgggatcccttgtgaggctgccctc
ATGGAGTTCCCCCTGGCCCAGATATGTCCCCAAG
gtaagtgtgaagttgaaggatatgggtgggagggggcacaaagacccccatccccctgcc
ctccctcctgggcttgagctcccacttcagggatgaggggccccaccctaagccagagct
ggcaaagctgattggcagggtgaccacaaccctgcctggggctccatgcccactcatccc

 1.02 Intr +   1917   2005   89  1  2   82  101   126 0.988  13.49
atgccgccttggctacttaacctcatgcctgagaaactcccctgctgcccttctgcgttt
ttcctgtcgttaagactgtcccagccctccagatcccctgagcctgggaggaggggtggg
aggcagagacagacatagttcctctctgagaaaccccggcagccctctttgtgctcacag
GGAGTCACGAAGCCCCCATCCCAACCTTCAGCACCTTCCAGATCACAGACATGACCCGCA
GGAGCTGCCAGAACCTGGGCTACACTGCG
gtgagtggaaacctggggcggcagcgtggtgcagctccctcatctctcccaccctcccat
ggggaaggacttgcagatggacaaaggccactccaagagaaggcaggaatgatccgggtc
tgccaacgggctggggcacagagagagagaacgaaaatgaggagtacctccttcatgcgc

 1.03 Intr +   2790   2974  185  2  2   74  105   124 0.688  11.80
acagctggagctgaagaagggatttaagttagactttaggaaggactttctgggcaattg
taccctaaaatagacaggagaggctgggtatgaggaaaagaaggtggcaggtggatcaaa
gtcaggagaaggcccactcatcatgctgcttccccctccttgaactcttccctgatccag
GCATCTCCCCAGGCCCCGGAGGCTGCCTCCAACACAGGGAATGCTGAGAGGGCAGAGGAG
GTGCCTGGAGAAGGAAGCCTGTTCCTGCAGGCCGAGACCCGGGCTTGGTTCCAGAAGACC
CAGGCCCACTGGCTCCTGCAGCACGGGGCAGCCCCTGCCTGGTTCCATGGCTTCATCACC
CGGAG
gtgagtcatggaggaggaaattggcccagacaggggcagggcaagtcctgggtctgggtc
ctgccacctgccaggaatagatgaaggctcccacttctaccagtctggagtagatggagg
cgcccactccaggctcccactcccagagttttcctagcctttcactgaggcatctctcca

 1.04 Intr +   3717   3806   90  0  0   99   94    88 0.999  10.11
aatccctgcagcgggagagcagcgcccacgtgctctctctccccatctccgccctagcct
ttctctagccgctccagcatgcttgcttgggggtaggggttcctcgtgagagccggggag
acagaggcgaggctggaagtgtcagagcagggttcggccccctctctccgtcacccacag
GGAGGCAGAGAGGCTGCTGGAGCCCAAGCCTCAGGGGTGCTACTTGGTGCGGTTCAGCGA
GAGCGCGGTGACCTTCGTGCTGACTTACAG
gtgaggggcgaggccccgcgccgggcgacacaaggcggggctcgggaggggcggggcttg
ggtctgatcccgtgaggagccgggctcttagctcattccccgggctgctgaaggtgggga
tcacgcctctcgctggtgaccctggccgaggagcgggagatagtctgatccctaacggcg

 1.05 Intr +   3995   4163  169  2  1   39  101   310 0.964  27.86
cgaggccccgcgccgggcgacacaaggcggggctcgggaggggcggggcttgggtctgat
cccgtgaggagccgggctcttagctcattccccgggctgctgaaggtggggatcacgcct
ctcgctggtgaccctggccgaggagcgggagatagtctgatccctaacggcgccctccag
GAGCCGGACTTGCTGCCGCCACTTCCTGCTGGCCCAGCTCAGGGACGGGCGCCACGTGGT
GCTGGGCGAGGACAGCGCCCACGCGCGGCTGCAGGACCTGCTGCTGCACTACACCGCGCA
CCCGCTCAGCCCCTACGGGGAGACGCTCACCGAGCCCCTCGCCCGACAG
gtacgcgccccagaccctgaccagagagcccagggtctcgggccagcgcccctcccgctc
agagcccaggcgcaggacgcggcaccaggcactttctcatcccgaaacaccactcgggca
tgcctcccttacccaggcatcttcatcttcatgggagggtggcaggcccttcgagaaata

 1.06 Intr +   8204   8350  147  1  0   70   57    71 0.723   3.14
ctgggtctccctgccgtcaccaccccctcttcctcatccagggaacccagcccaggccaa
atttctgtgctcctcccccttcccccatcctccacttagactggattattttgtcctcct
gatcacctcccccaccccaacgctccaccgagtgcctcagacctccttctttcccagcag
ACTCCTGAGCCTGCAGGACTTTCCCTGAGGACCGAAGAATCAAACTTTGGAAGCAAAAGC
CAGGACCCAAACCCCCAGTACAGCCCAATCATCAAACAGGGGCAAGCCCCAGTCCCGATG
CAGAAAGAGGGGGCCGGGGAGAAGGAG
gtattgggctgcaggggctgagggagtgggaggacaggcctgcgagggggtgcaggcagc
ggggaggaggaggggcctagcgggggcagaggctcaggctgggagttaggctggggcttt
aaccctgcctccctcaccccactcctccctggcctcaccttctctcccagccctcccagc

 1.07 Intr +   8521   8808  288  0  0   93   99   193 0.495  18.88
ggagaaggaggtattgggctgcaggggctgagggagtgggaggacaggcctgcgaggggg
tgcaggcagcggggaggaggaggggcctagcgggggcagaggctcaggctgggagttagg
ctggggctttaaccctgcctccctcaccccactcctccctggcctcaccttctctcccag
CCCTCCCAGCTGCTCAGGCCCAAGCCTCCCATCCCCGCCAAACCTCAGCTGCCCCCAGAA
GTCTACACAATCCCTGTTCCACGACACCGCCCGGCCCCACGCCCCAAGCCCTCCAATCCT
ATCTACAATGAGCCTGATGAACCCATAGCTTTCTATGCCATGGGCCGGGGCAGCCCTGGG
GAAGCCCCCAGCAACATCTATGTGGAAGTGGAAGATGAGGGCCTACCCGCCACCCTTGGG
CACCCTGTCCTACGGAAGAGCTGGTCCAGGCCTGTCCCAGGAGGCCAG
gtaaatgggtatgcagggaaaggtaggtgcaagaaggtctccctgcaggtagatggggga
aggtgaagaaggtgttcagagtggatgcctggggcagggtaaggggcagaggtgtgaggt
gatgtgggaagaacagaatgatccaggcaccagcctcccttctccaggcccagaggctgc

 1.08 Term +   9335   9340    6  1  0  131   41     0 0.263  -2.25
ctggggctgaccccaccccgtgcctctctggctctctcccttggccttcacggccctgct
gtcctggagaaaaagagcacttgggttcccttatgtcatctcagtgagctcaggggaggg
ggaccctgctctcccagcctgcttctgtgtactccctgtctccctcttccttctccccag
CCCTAA
gtcttcttgcctacccttcaagtcagtacctcatgccatgggttagccccagcagccatc
ccaccctctccctcggcctctgcggccctcccaaagcccttccccagcctccctcctcag
acccttccccatcctccctccttgctggtgccccaggctccctgctcagcctgagcctgc

Predicted peptide sequence(s):


>SH2D2A_1|GENSCAN_predicted_peptide_1|335_aa
MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASNTGNAERAE
EVPGEGSLFLQAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLEPKPQGCYLVR
FSESAVTFVLTYRSRTCCRHFLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSPYGE
TLTEPLARQTPEPAGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAPVPMQKEGAGEKEPS
QLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIYNEPDEPIAFYAMGRGSPGEA
PSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQP