GENSCAN 1.0	Date run: 14-Jan-104	Time: 16:31:43

Sequence SELE_1 : 13797 bp : 38.73% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1579   1663   85  0  1  119  106   -16 0.577   1.77
cctaaataatgaaagtcttaaaatttgtttatttatttgattaaactctgaaataaagat
tattgcactagtgtcctttgcccaaaatcttaggatgctgccttaaacatcatggtagaa
taatgtaactagctacccacgatttccttctttaattcattttgtgttttatctccccag
GAAAGTATTTCAAGCCTAAACCTTTGGGTGAAAAGAACTCTTGAAGTCATGATTGCTTCA
CAGTTTCTCTCAGCTCTCACTTTGG
gtaagtcagtgccattagaccaagatttctcattctcgcactatagatatttcagactga
aatatccttgcttgtctggggctgtcctgcacaggatatctggcagcatccttgacctct
acctgcaatgtgttcttccctgggcttggggtcatttactttacctcttggtgtctccct

 1.02 Intr +   2241   2624  384  1  0  101   91   306 0.836  26.10
caaaagagataaacaataagtcgctgtttcttcatacgtacttcttacttttgaaaagat
gagaaaagtctgggccatgtcacaaacattgccaaaaataagacaataaaaagcacagtt
gtcagagttaaaccacaacagtaccaaactctaccatttcttttctttttctcccactag
TGCTTCTCATTAAAGAGAGTGGAGCCTGGTCTTACAACACCTCCACGGAAGCTATGACTT
ATGATGAGGCCAGTGCTTATTGTCAGCAAAGGTACACACACCTGGTTGCAATTCAAAACA
AAGAAGAGATTGAGTACCTAAACTCCATATTGAGCTATTCACCAAGTTATTACTGGATTG
GAATCAGAAAAGTCAACAATGTGTGGGTCTGGGTAGGAACCCAGAAACCTCTGACAGAAG
AAGCCAAGAACTGGGCTCCAGGTGAACCCAACAATAGGCAAAAAGATGAGGACTGCGTGG
AGATCTACATCAAGAGAGAAAAAGATGTGGGCATGTGGAATGATGAGAGGTGCAGCAAGA
AGAAGCTTGCCCTATGCTACACAG
gtagggagtttgcggcagcagtgggaggtagtttcagtgtgtgggcatcttggcaaattt
acagcatgcaaaaactgctctctattgtggtcattttatgttccaaaagattctgtttaa
ctgctaaagtttctctcttttgctgttttgtgtgaatgtgggcaagaatatgtggatatg

 1.03 Intr +   3297   3404  108  1  0   85  106    84 0.995   9.24
aggtttaggataggtgggcctgaaactcagatttggaactttgtaaaacacttcagttaa
agtctatggcactctgtaggactgctgatgtctctgttgcacactgttgattctaaaatc
aaaggcactcagtataagcacagtaatagtcctcctcatcatgctttgtattttccgtag
CTGCCTGTACCAATACATCCTGCAGTGGCCACGGTGAATGTGTAGAGACCATCAATAATT
ACACTTGCAAGTGTGACCCTGGCTTCAGTGGACTCAAGTGTGAGCAAA
gtaagtctggttcttgcctctttcttcacttgagatggtagcaccatctcacgtcctagc
tggcattagagtcaggtctgcatgccttcccttccctggtgcagatggtgtcatatggtg
atcgtgagctgagactatgaagtcagaccctgctgggtttgagtcctagattcaccagtt

 1.04 Intr +   5566   5751  186  2  0   55   75   194 0.998  13.54
gaatatccatgaaaaagaataaaagcttttattctggctgtgcatgtccctaagaattga
cataggactttgggatctaccctttgaaggcagcttcctcactctgttaggcacccagct
caataggaagtgaaaagatcattcttctgtaaaattcatggtgctctttaaaatcctcag
TGGTTGAGTGTGATGCTGTGACAAATCCAGCCAATGGGTTCGTGGAATGTTTCCAAAACC
CTGGAAGCTTCCCATGGAACACAACCTGTACATTTGACTGTGAAGAAGGATTTGAACTAA
TGGGAGCCCAGAGCCTTCAGTGTACCTCATCTGGGAATTGGGACAACGAGAAGCCAACGT
GTAAAG
gtagagttgttccacatggagacttactgtgaacattctttctctcaacccatactggaa
atgggcaagctaattctaggccgtgctaatatcaatgcgtatatttgttacagctgtgac
atgcagggccgtccgccagcctcagaatggctctgtgaggtgcagccattcccctgctgg

 1.05 Intr +   5865   6053  189  1  0   52  121   130 0.998  11.34
atgggagcccagagccttcagtgtacctcatctgggaattgggacaacgagaagccaacg
tgtaaaggtagagttgttccacatggagacttactgtgaacattctttctctcaacccat
actggaaatgggcaagctaattctaggccgtgctaatatcaatgcgtatatttgttacag
CTGTGACATGCAGGGCCGTCCGCCAGCCTCAGAATGGCTCTGTGAGGTGCAGCCATTCCC
CTGCTGGAGAGTTCACCTTCAAATCATCCTGCAACTTCACCTGTGAGGAAGGCTTCATGT
TGCAGGGACCAGCCCAGGTTGAATGCACCACTCAAGGGCAGTGGACACAGCAAATCCCAG
TTTGTGAAG
gtaagcttgagatccttcgatttatactttcttaaagaacaaccatcttcaaacttggac
agtgaaaaaaaaaaccaatacccactttaactatagaaatcagatttgatgagcaaccct
cgtatctttgagattcatttaaaagaactaatgtttggccagggaaaggatcatatgtgt

 1.06 Intr +   6993   7181  189  1  0   49   87   211 0.974  15.74
catgatcagtgagggggctgaaattcaaagaaaacacagccatcttcccatttgtccagg
gaattataaagaatcttcagttctccaagtgttgcttgaatgaactgggttcactcaaca
aacgccaagtactctctagttccactgcaatattttctgaccatcattttgatgtctcag
CTTTCCAGTGCACAGCCTTGTCCAACCCCGAGCGAGGCTACATGAATTGTCTTCCTAGTG
CTTCTGGCAGTTTCCGTTATGGGTCCAGCTGTGAGTTCTCCTGTGAGCAGGGTTTTGTGT
TGAAGGGATCCAAAAGGCTCCAATGTGGCCCCACAGGGGAGTGGGACAACGAGAAGCCCA
CATGTGAAG
gtacagtctttgtttttattttattttaagataaaaagaactattgaagagcttgggaac
ttggttaccttgggaaacgtattgctggagatgcaaacaaacttctaaagtgctctctcg
tgtgttccagctgtgagatgcgatgctgtccaccagcccccgaagggtttggtgaggtgt

 1.07 Intr +   7312   7500  189  2  0   73   70   117 0.985   7.04
ccaatgtggccccacaggggagtgggacaacgagaagcccacatgtgaaggtacagtctt
tgtttttattttattttaagataaaaagaactattgaagagcttgggaacttggttacct
tgggaaacgtattgctggagatgcaaacaaacttctaaagtgctctctcgtgtgttccag
CTGTGAGATGCGATGCTGTCCACCAGCCCCCGAAGGGTTTGGTGAGGTGTGCTCATTCCC
CTATTGGAGAATTCACCTACAAGTCCTCTTGTGCCTTCAGCTGTGAGGAGGGATTTGAAT
TACATGGATCAACTCAACTTGAGTGCACATCTCAGGGACAATGGACAGAAGAGGTTCCTT
CCTGCCAAG
gtagaattgagtgcagacttttttagggtacaggtcaaatacttcataaagtttctgaac
ctagattgccccaaaggggtttggtcctaatttcctacatgctgaaaactaagtagcgct
tacactttacattcattgttgacttttaagcaagttttggaagttttccagtagattttt

 1.08 Intr +   7714   7890  177  2  0   62   59   153 0.908   8.77
gtcaaatacttcataaagtttctgaacctagattgccccaaaggggtttggtcctaattt
cctacatgctgaaaactaagtagcgcttacactttacattcattgttgacttttaagcaa
gttttggaagttttccagtagatttttctgaaactctgcctgtgtacctaacatttgcag
TGGTAAAATGTTCAAGCCTGGCAGTTCCGGGAAAGATCAACATGAGCTGCAGTGGGGAGC
CCGTGTTTGGCACTGTGTGCAAGTTCGCCTGTCCTGAAGGATGGACGCTCAATGGCTCTG
CAGCTCGGACATGTGGAGCCACAGGACACTGGTCTGGCCTGCTACCTACCTGTGAAG
gtgatgcattgattgatggtggttgtctggtgattaaaaagaaaaagggggagctatctt
gttacagtaatcaactattcattatatccaaaccagaaagttcgcccaggttgacaagtt
gtgaatattaagttgtatggggatagagaaaaaacagaagttgcatgttgatggaaaggg

 1.09 Intr +   8433   8540  108  1  0  121  100    39 0.820   7.74
aaaggtggcttggagcagatctcaaaggcctgtaatgccacatctctgcttcttgtatta
aactagatagctcttctgctcctagtaatgaatgtacagaaaaaaggccaaagggacagg
acggagagactttaacatcaattcttcctcatgacctttcttcgtctcttacttccttag
CTCCCACTGAGTCCAACATTCCCTTGGTAGCTGGACTTTCTGCTGCTGGACTCTCCCTCC
TGACATTAGCACCATTTCTCCTCTGGCTTCGGAAATGCTTACGGAAAG
gtgaggaagtttatgaatgtacttcaaaaatgtttttgaaaatacatttctttctcattg
ataagtcatggtcttgcttactgatttaaacaataattagaatctggataaaatgcagta
taattaagcagaagtattaagaaaagagttagtagtacaactcagtgtgggaagtgtttc

 1.10 Intr +  10826  10990  165  0  0   43   67   100 0.289   2.41
tctgtgttagaaggtacattttgttgtcatgatcagtatgcagaatattaagtgttctga
tgacatgcatgtttatatttacagaaacaggtgcatctggggaactagagggatacactg
aagttaacagagacagataactctcctcgggtctctggcccttcttgcctactatgccag
ATGCCTTTATGGCTGAAACCGCAACACCCATCACCACTTCAATAGATCAAAGTCCAGCAG
GCAAGGACGGCCTTCAACTGAAAAGACTCAGTGTTCCCTTTCCTACTCTCAGGATCAAGA
AAGTGTTGGCTAATGAAGGGAAAGGATATTTTCTTCCAAGCAAAG
gtgaagagaccaagactctgaaatctcagaattccttttctaactctcccttgctcgctg
taaaatcttggcacagaaacacaatattttgtggctttctttcttttgcccttcacagtg
tttcgacagctgattacacagttgctgtcataagaatgaataataattatccagagttta

 1.11 Term +  11109  11143   35  1  2   87   48    53 0.493  -2.03
tactctcaggatcaagaaagtgttggctaatgaagggaaaggatattttcttccaagcaa
aggtgaagagaccaagactctgaaatctcagaattccttttctaactctcccttgctcgc
tgtaaaatcttggcacagaaacacaatattttgtggctttctttcttttgcccttcacag
TGTTTCGACAGCTGATTACACAGTTGCTGTCATAA
gaatgaataataattatccagagtttagaggaaaaaaatgactaaaaatattataactta
aaaaaatgacagatgttgaatgcccacaggcaaatgcatggagggttgttaatggtgcaa
atcctactgaatgctctgtgcgagggttactatgcacaatttaatcactttcatccctat

Predicted peptide sequence(s):


>SELE_1|GENSCAN_predicted_peptide_1|604_aa
ESISSLNLWVKRTLEVMIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRY
THLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNN
RQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCK
CDPGFSGLKCEQMVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQC
TSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQ
VECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKG
SKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFE
LHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTL
NGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKDA
FMAETATPITTSIDQSPAGKDGLQLKRLSVPFPTLRIKKVLANEGKGYFLPSKVFRQLIT
QLLS