GENSCAN 1.0	Date run: 14-Jan-104	Time: 20:28:26

Sequence S100A1_1 : 6040 bp : 54.87% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   3326   3466  141  1  0   77   50   307 0.654  25.90
ggtttccctcacattgtaaaatctcagggaaagatcaattgcagtagggctctaatccca
cagctatttgagctgtcagccagggccagtcctgagggttcccctcacctagaccccagg
tactccgggcctggtcctcagctcacttccatgatgggggtgggtaggtgcactgctgca
ATGGGCTCTGAGCTGGAGACGGCGATGGAGACCCTCATCAACGTGTTCCACGCCCACTCG
GGCAAAGAGGGGGACAAGTACAAGCTGAGCAAGAAGGAGCTGAAAGAGCTGCTGCAGACG
GAGCTCTCTGGCTTCCTGGAT
gtgagcatagagtggtggagtgggagtggagtgggtgaaggttgggggaatggggtggac
acccccttgctatctccccaccccacctccagctcagcctagcctctttctttcctttcc
caggcttctctcctgggtttttccaggctcccctactcctcctgggtcaagtcaaaatgc

 1.02 Term +   4502   4645  144  1  0  134   53   216 0.999  20.92
gagcttatgctgtaggcaacagaagccctcaagacctttgaggaggcctagaagagtccc
ataattcaatgcagttcctctcgctcatctttgcctcctgctcctcaaccacccccttgc
ctctgactcagtgctgtacccttccctatacacctccctcttcctctcctcccaccacag
GCCCAGAAGGATGTGGATGCTGTGGACAAGGTGATGAAGGAGCTAGACGAGAATGGAGAC
GGGGAGGTGGACTTCCAGGAGTATGTGGTGCTTGTGGCTGCTCTCACAGTGGCCTGTAAC
AATTTCTTCTGGGAGAACAGTTGA
gcagacagccacattgggcagcgcccttcctctccaccctcccagacctgcctcttcccc
ctgcttccacctcaccccacttatccctctccataaccccacccttgcccaccccacccc
cacccccaccaagggcgcaagagtagcggtccaagcctgcaactcatctttcattaaagg

Predicted peptide sequence(s):


>S100A1_1|GENSCAN_predicted_peptide_1|94_aa
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMK
ELDENGDGEVDFQEYVVLVAALTVACNNFFWENS