GENSCAN 1.0	Date run: 14-Jan-104	Time: 19:48:33

Sequence PRKAB2_1 : 14979 bp : 41.45% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1178   1356  179  0  2   66  121   303 0.580  30.12
agtgagggcaccggggtatttgcaggcgttcccgcaggccaggagggagagggctccagg
gctcggcttccctggggcggggaatcccttgccctgtcccgaggcgcaggggcggggccg
gggggcgcccctgacgcggcggctgaggtgttcccagcccggtgtcgttccccgcggtag
GTGGTCCCCGACGAGCTGCAGCCATGGGAAACACCACCAGCGACCGGGTGTCCGGGGAGC
GCCACGGCGCCAAGGCTGCACGCTCCGAGGGCGCAGGCGGCCATGCCCCGGGGAAGGAGC
ACAAGATCATGGTGGGGAGTACGGACGACCCCAGCGTGTTCAGCCTCCCTGACTCCAAG
gtaagcgtcccatgcccgcagttggtgtcagtactgcagcgggttgatttctgggctcct
cttccctttcttggttcttttctaccgcgccgaaccgggctatggttttttgaattaaag
ggatttatcggggacagaggtgttggatgataattcctcttgaagtgccgcctcaaaata

 1.02 Intr +   2020   2169  150  0  0  112   47   107 0.920   8.44
gtgatcctcttcccttttggcacggctgtaagcagcaactacttgcttattgaatacttt
ctcctagtcttggggatcaattaaggacatcatttagttgactgcttaatttttgtccca
tactttatagttgtggtggctgaggctgtgcctctttcacgccccgctgctgctccgtag
GTGGAAGAGCCAATGATTCCACGACTTGTTTACTCCTCAGTAGTACTTCAAAATGTTGCG
TGGCTAAAAAAACGACAACCCACAGCTGCCCTGAAGACCTTGCTCTCAATTCCAAGGACT
TTCAGGAAGAGAACAACTTGTTTTCACTCT
gtaagaaaggacagatggagctgatagcagcgattaccattctaatgtttctaatggctt
tcagagctgtcagcatgaaatacaagtaattcctccaggtagactgactggatgagatag
aaaaatggagggcttgaggagattcgggtgtgtttgatgtttcctatcatttcatcactt

 1.03 Intr +   5412   5578  167  2  2   62   46   188 0.743   9.84
tttttggtcctagatgagttctttttctataatttgttcaaactctgatttagttgctaa
ttttggggtttatatccttagccaaagcctagcacccttctctatcctagggaggagagt
gacctttttagaattcttgggtcacagtttattctagggatgacctactccttcttacag
CTCCCTGGGGACAAAGAGTTTGTATCATGGCAGCAGGATTTGGAGGACTCCGTAAAGCCC
ACACAGCAGGCCCGGCCCACTGTTATCCGCTGGTCTGAAGGAGGCAAGGAGGTCTTCATC
TCTGGGTCCTTCAACAATTGGAGCACCAAGATTCCACTGATTAAGAG
gtgacaagtgtcttggttgaatctaagggtccaggaatagagacctgatttcttttctca
gaagagagacccagctggacttttctccacctactaaggactgtctctagaacatgccct
tttctgcggccacttagtatatctgtgggatttttttttaacctcatagtgagtcagaga

 1.04 Intr +   6406   6499   94  1  1   84   94    90 0.976   8.25
tacatgtccaagatgatacagaaaaggagaatgggtttatacgttgttttttacaccagg
ggatacaatggcttaggaatctgggaaattattcatatgatactatgattgccacttgtt
ttttagattcagtcttctaaaaggaacttggcctgtttgcctttcttttttcttctgtag
CCATAATGACTTTGTTGCCATCCTGGACCTCCCTGAGGGAGAGCACCAATACAAGTTCTT
TGTGGATGGACAGTGGGTTCATGATCCATCAGAG
gtaaggccttgatctccaagggtaaccattgacttagcagtctcattttagctgtcattt
ctgtcaagactgatgggcagctgctcccctacactggaggatttctctcttgataaaacg
tggaggtgctgagaacaatcgtgtaaattttagtaaaagaggaaggttggatggaagaga

 1.05 Intr +   6727   6847  121  0  1   61   76    58 0.863   1.05
ttagctgtcatttctgtcaagactgatgggcagctgctcccctacactggaggatttctc
tcttgataaaacgtggaggtgctgagaacaatcgtgtaaattttagtaaaagaggaaggt
tggatggaagagatggatttgaaagagagattcaataattttttctattcactgtttcag
CCTGTGGTTACCAGTCAGCTTGGCACAATTAACAATTTGATCCATGTCAAGAAATCTGAT
TTTGAGGTGTTCGATGCTTTAAAGTTAGATTCTATGGAAAGTTCTGAGACATCTTGTAGA
G
gtaattttgtattatttactctctcttgctgtgtctttcttgtagttccttcctaaaagt
tgtttatgtgtgtatatacatatagagggagagagagagcagggggttggggggaggaga
gagagagacagagatttttctcctgtaaacatttaggtctcttatttgcagcaaacacaa

 1.06 Intr +  10772  10905  134  0  2   67   65    65 0.811   1.54
atgtccaggggactcagatttttcctctggttaccttacagctgtagatcccacaggtca
caagtttgtgatccaggacttctaccatatttaatgttagctgccatgtattgatagctt
tttccatgcattcttgctaattctccaactctttctcatatttgtataaatatctttcag
ACCTTTCCAGCTCACCCCCAGGGCCTTATGGTCAAGAAATGTATGCGTTTCGATCTGAGG
AAAGATTCAAATCCCCACCCATCCTTCCTCCTCATCTACTTCAAGTTATTCTTAACAAAG
ACACTAATATTTCT
gtgagtatcctgagtattactggggcatctgggggtgtctaggaccatttggaccaaagt
tcagtaatcctagaggttaggattactacagaggtgtgttgagattataagtcatacaca
taccaataacattacagatttcctttttccagtggtgagtcacagctttttcaggtactg

 1.07 Intr +  11565  11633   69  2  0   83  115    14 0.790   2.06
aattttctgtaataggattgtattattgatacatactagagtgggtgcattattgaaaag
agatagcgcattctagtttaaatttctcaaagagctctgaggaagagtaagctgtttggt
ttgtctgtgcattaatttcatttagtaatttttttagtaatttttttctctttctcttag
TGTGACCCAGCCTTACTCCCTGAGCCCAACCATGTTATGCTGAACCATCTCTATGCATTG
TCCATTAAG
gtaagtggtggccctggctcttcacagagctccctggaatgagaggtcaagggtaacata
cgttctcagtggttactttctctgctatttcattgaagctgaagctggcagtaatgatca
aattatagaagaactctcttttttttaactactaggttgtttgttttaaaatctcagtct

 1.08 Intr +  12730  12801   72  0  0   85   70    38 0.532   0.38
taagtaccagagacaggactgctgaggtccagtcctcctatgctgacttcatattctttc
ctatattatcattatgccaggtctttccaagtaggtttttctcaggtattcctcatttcc
acaaaacctgtggaagtgtaaaagtgaattgtttacctgccttgcttctgtcgtatttag
GCTTTGTGTCAGCATGACTCTGGAGTGTTAACCCGAGAAGCATTCATGGTGGATAATACA
GTACGGGGGAAG
gtagaaggatacacttgttcttaatcggatttgcttgggttctttgggatctgatggatt
ttgcctcctgtaactgctccttggatgtcatttaatttgcctaggcttgccatctcctcc
tgtggtacatctgtagtctacaacacagcctgggaaatggtacctcttgctgtcttctta

 1.09 Term +  13703  13780   78  1  0  109   49    96 0.960   4.58
ccaaggccacaagtagaatgatgataggagtcagaattggaactaaaacttatttgacct
cctgctcttatatcaaactatctctgttaaaagtgagtgactgtgaaggactgatgactg
ggaagagctacctactgtctgaagtaatgaattagctgcgtatgtttcttttccttgcag
GACAGTGTGATGGTCCTTAGCGCAACCCATCGCTACAAGAAGAAGTATGTTACTACTCTG
CTATACAAGCCCATTTGA
agggatcccttcttgcctctaaggattcaggagaagcatctcccttgcatttctggactg
aaccagtcttacctgagactggaaggctgatttgctttgaggctgatatgtgtgtttcag
agcctctgagtaggatgctctgcttttgcatttgattgcagatgagagctttatgagttc

Predicted peptide sequence(s):


>PRKAB2_1|GENSCAN_predicted_peptide_1|354_aa
XGPRRAAAMGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSK
VEEPMIPRLVYSSVVLQNVAWLKKRQPTAALKTLLSIPRTFRKRTTCFHSLPGDKEFVSW
QQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGE
HQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLS
SSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLY
ALSIKALCQHDSGVLTREAFMVDNTVRGKDSVMVLSATHRYKKKYVTTLLYKPI