GENSCAN 1.0	Date run: 14-Jan-104	Time: 15:17:25

Sequence PRDX6_1 : 13860 bp : 42.22% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1252   1346   95  0  2  101   99   157 0.800  18.00
cccagcccagcccccgcggcccggcccccagcggccggcctcccgcggccccgcccccgc
cgccccagtccccgcccctcgcgccttcgtttattcctccgcgcgctgggacaggctgct
tcttcgccagaaccaaccggttgcttgctgtcccagcggcgccccctcatcaccgtcgcc
ATGCCCGGAGGTCTGCTTCTCGGGGACGTGGCTCCCAACTTTGAGGCCAATACCACCGTC
GGCCGCATCCGTTTCCACGACTTTCTGGGAGACTC
gtaagtggccaccgcgtagccctgtcctggcctcggttgcgccggactcggaggtgcctt
ccctgtttcttctccctgccgtcctcccggccgctcagccccctgcgccgccctcgcctt
cccccgcactggttccggcgcgcgccaggccgtgtggcctctgctcagcgtcggctgcgc

 1.02 Intr +   5180   5336  157  2  1  136   96   127 0.999  17.39
ctctggaggtaagtagattgaaaagcactcctcaacagaaaagcttaaaagtaaatatca
tcataagcattcatttaaaaaagaaagcctgtttttgatccagaagttgtgacttttcat
tctctgtgatgttggtgataactcttaattcaattgtgaccttgtttttcttcctttcag
ATGGGGCATTCTCTTCTCCCACCCTCGGGACTTTACCCCAGTGTGCACCACAGAGCTTGG
CAGAGCTGCAAAGCTGGCACCAGAATTTGCCAAGAGGAATGTTAAGTTGATTGCCCTTTC
AATAGACAGTGTTGAGGACCATCTTGCCTGGAGCAAG
gttagtatcaattggcatgtgctttgagcctgagattataggtcaagttataaattatgg
agtacttggttttgaggttaaggtacaagtaagccttaggttcaaagttcactaattatt
tgaaaatttcagttgaaccacacagtgatcacattgctaaatccattggtcagtcaattc

 1.03 Intr +   9215   9361  147  1  0  103   66   203 0.999  19.11
cctggcaataattggaatgaagagtgttcatctactcactttttaaaattaaaattgctt
aaagaaaattactgtgatttggtcctctttcctgtcttgcaaggtgatggctgttaactg
atgaaattcagagcatgtgttgggtttagattcctctttccccttttacttgtgtttcag
GATATCAATGCTTACAATTGTGAAGAGCCCACAGAAAAGTTACCTTTTCCCATCATCGAT
GATAGGAATCGGGAGCTTGCCATCCTGTTGGGCATGCTGGATCCAGCAGAGAAGGATGAA
AAGGGCATGCCTGTGACAGCTCGTGTG
gtaggtcatacaaattcattttgtagttagcttaactgatcaggctgtatgtccgtgtaa
atgctggtaccagctagaggagataggggaatatctacgattatgaaataactgtgtatt
ggcgacaatatcactgattatctgtaatgctgatgcaattttcagctaaattttccaact

 1.04 Intr +  10109  10255  147  1  0  117   98   104 0.999  13.81
gggagaagaaaattatctgtattccagccatccacattagcagttggtgtatccttctag
atgctttgtttttgtcttgtttttatacccttgaacattattaatgactgcagagctttc
taagtggctttaataacactcaaagaactcttcctatttatgcccctctgtgctttacag
GTGTTTGTTTTTGGTCCTGATAAGAAGCTGAAGCTGTCTATCCTCTACCCAGCTACCACT
GGCAGGAACTTTGATGAGATTCTCAGGGTAGTCATCTCTCTCCAGCTGACAGCAGAAAAA
AGGGTTGCCACCCCAGTTGATTGGAAG
gtaaagatgtttttaaaaagcagtttctctacttgcctgaagggccagtctctaaatggc
caacttcaaggtctgtgttacctgtttctagcacgcaagtacactgggaggatttttcct
catggctgagttcaagatttgctgaaaggcccttttcaaggtctttataacaccttttat

 1.05 Term +  11589  11717  129  2  0   77   41   139 0.999   5.30
tgctttcctgccaaaagtgccaaagatcaacttggaaaacaaaatcctcacagaggggag
agtaaagaacacttgattagtctcattagcacctgtagctacttttctaaagttaattcc
tgaaggccttgaagcttcactatgagattgaatttcaccattctcaatgtctttcaatag
GATGGGGATAGTGTGATGGTCCTTCCAACCATCCCTGAAGAAGAAGCCAAAAAACTTTTC
CCGAAAGGAGTCTTCACCAAAGAGCTCCCATCTGGCAAGAAATACCTCCGCTACACACCC
CAGCCTTAA
gtctcttggagaagctggtgctgtgagccagaggatgtcagctgccaattgtgttttcct
gcagcaattccataaacacatcctggtgtcatcacagccaaggtttttaggttgctatac
caatggcttattaaatgaaaatggcactaaaagtttcttgagattctttatactctctgc

Predicted peptide sequence(s):


>PRDX6_1|GENSCAN_predicted_peptide_1|224_aa
MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPE
FAKRNVKLIALSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPA
EKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD
WKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP