GENSCAN 1.0	Date run: 14-Jan-104	Time: 17:12:05

Sequence PRDM2_1 : 122625 bp : 43.42% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.06 PlyA -    440    435    6                               1.05
 1.05 Term -   2020   1860  161  2  2   24   42   161 0.012   3.20
 1.04 Intr -   4077   4037   41  2  2   98   71    31 0.011   0.27
 1.03 Intr -  19826  19694  133  0  1   84   34   158 0.767   9.70
 1.02 Intr -  23335  23220  116  0  2   75   47    98 0.199   4.49
 1.01 Init -  27537  27392  146  0  2   76   49    83 0.462   1.41
 1.00 Prom -  28280  28241   40                              -4.26

 2.01 Init +  45101  45219  119  1  2   47   78    70 0.790   1.58
tttccccaaattctaggggtgtgaactttgcactcagtggatcttttcttcgggatcttg
ttctgggtggaatcaatttgatggtggccctcactacttccagtcatacgtggcttaaga
atgtgatggtttaggagcataatacatgggagatacttcctgctgtatttaaaagttaaa
ATGTGGAAGTTTGATGTCCGGTCCGAAGGGCGAGGCACGGACCTCCCTGGACCAGAGCAG
GTTGGTGGCCCCGGGCGGCCTCCCGTTGGCGGCTCTGGGATAGAAACCGCGGCGCATTT
gtaagtgcttgcgcgtggttcctcctcgttgtcctgttgaagttgctcttggtctggaac
gcgcgctagtcgttgtctttcagcactccgctttccacaccgcacgcttttcagttatgc
tttacatttctcctcgacttagatttcgtgagcaaaatgggcccatgttttattttttct

 2.02 Intr +  45519  45636  118  0  1   66   78    64 0.680   3.67
ctttacatttctcctcgacttagatttcgtgagcaaaatgggcccatgttttattttttc
tcgtgcgtgggccgtcgtgaggctttaaacaggaaactgggacagcacccgggctccgct
acccgtcaccgggccttccgcgcccctcgccccacgccgcgggtgcggtcctccctccag
CAGAGGGTTCCGGGCGCCGGCGCGGCCCGCACGGGGCCGGGAGCCCTTCCTGCCGGCCGG
GTGCGCGCGGCGCCGCCGACAGCTGTTTGCCATCGGCGCCGCTCCCGCCCGCGTCCCG
gtgcgcgccccgcccccgccaacaaccgccgctctgattggcccggcgcttgtctcttct
ctccccgcagccaatcgcgccgggcgaggagctcctggtctggtacaatggggaagacaa
ccctgagatagcagctgcgattgaggaagagcgagccagcgcccggagcaagcggagctc

 2.03 Intr +  45707  45833  127  1  1  116   97   140 0.975  17.95
tccgggcgccggcgcggcccgcacggggccgggagcccttcctgccggccgggtgcgcgc
ggcgccgccgacagctgtttgccatcggcgccgctcccgcccgcgtcccggtgcgcgccc
cgcccccgccaacaaccgccgctctgattggcccggcgcttgtctcttctctccccgcag
CCAATCGCGCCGGGCGAGGAGCTCCTGGTCTGGTACAATGGGGAAGACAACCCTGAGATA
GCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGAGCTCCCCCAAGAGC
CGGAAAG
gtaggagccccccggcccgcccgcccggccccggcgccacgcccgcccaggacgccgccc
tgccgccctcgctgctgctggcccgaccgcgaggcgggtcgcgggctcgggcggcggcgc
ccgcggcatctcggtgaccttttccggactcggccctgccccggccccgctcccgccctg

 2.04 Intr +  74764  79177 4414  2  1  109  115  1895 0.818 181.73
gattcatatccaatacaactttgtcaattaagtatataaagtagaagtaatttattgttc
atcatcatctcccttatgttttaggtggtaagagaaataacttgaatcattcagattgtt
caccaagtagctggtttcccatgcttcacttccatgcttctgcttccatgtgctttctag
GTCCTAAAGAAGACGAAGAGAAGCCTTCAGCCTCAGCACTTGAGCAGCCGGCCACCCTCC
AGGAGGTGGCCAGTCAGGAGGTGCCTCCAGAACTAGCAACCCCTGCCCCTGCCTGGGAGC
CACAGCCAGAACCAGACGAGCGATTAGAAGCGGCAGCTTGTGAGGTGAATGATTTGGGGG
AAGAGGAGGAGGAGGAAGAGGAGGAGGATGAAGAAGAAGAAGAAGATGATGATGATGATG
AGTTGGAAGACGAGGGGGAAGAAGAAGCCAGCATGCCAAATGAAAATTCTGTGAAAGAGC
CAGAAATACGGTGTGATGAGAAGCCAGAAGATTTATTAGAGGAACCAAAAACAACTTCAG
AAGAAACTCTTGAAGACTGCTCAGAGGTAACACCTGCCATGCAAATCCCCAGAACTAAAG
AAGAGGCCAATGGTGATGTATTTGAAACGTTTATGTTTCCGTGTCAACATTGTGAAAGGA
AGTTTACAACCAAACAGGGGCTTGAGCGTCACATGCATATCCATATATCCACCGTCAATC
ATGCTTTCAAATGCAAGTACTGTGGGAAAGCCTTTGGCACACAGATTAACCGGCGGCGAC
ATGAGCGGCGCCATGAAGCAGGGTTAAAGCGGAAACCCAGCCAAACACTACAGCCGTCAG
AGGATCTGGCTGATGGCAAAGCATCTGGAGAAAACGTTGCTTCAAAAGATGATTCGAGTC
CTCCCAGTCTTGGGCCAGACTGTCTGATCATGAATTCAGAGAAGGCTTCCCAAGACACAA
TAAATTCTTCTGTCGTAGAAGAGAATGGGGAAGTTAAAGAACTTCATCCGTGCAAATATT
GTAAAAAGGTTTTTGGAACTCATACTAATATGAGACGGCATCAGCGTAGAGTTCACGAAC
GTCATCTGATTCCCAAAGGTGTACGGCGAAAAGGAGGCCTTGAAGAGCCCCAGCCTCCAG
CAGAACAGGCCCAGGCCACCCAGAACGTGTATGTACCAAGCACAGAGCCGGAGGAGGAAG
GGGAAGCAGATGATGTGTACATCATGGACATTTCTAGCAATATCTCTGAAAACTTAAATT
ACTATATTGATGGTAAAATTCAAACTAATAACAACACTAGTAACTGTGATGTGATTGAGA
TGGAGTCTGCTTCGGCAGATTTGTATGGTATAAATTGTCTGCTCACTCCAGTTACAGTGG
AAATTACTCAAAATATAAAGACCACACAGGTCCCTGTAACAGAAGATCTTCCTAAAGAGC
CTTTGGGCAGCACAAATAGTGAGGCCAAGAAGCGGAGAACTGCGAGCCCACCTGCACTGC
CCAAAATTAAGGCCGAAACAGACTCTGACCCCATGGTCCCCTCTTGCTCTTTAAGTCTTC
CTCTTAGCATATCAACAACAGAGGCAGTGTCTTTCCACAAAGAGAAAAGTGTTTATTTGT
CATCAAAGCTCAAACAACTTCTTCAAACCCAAGATAAACTAACTCCTGCAGGGATTTCAG
CAACTGAAATAGCTAAATTAGGTCCTGTTTGTGTGTCTGCTCCTGCATCAATGTTGCCTG
TGACCTCAAGTAGGTTTAAGAGGCGGACCAGCTCTCCTCCCAGTTCTCCACAGCACAGTC
CTGCCCTTCGAGACTTTGGAAAGCCAAGTGATGGGAAAGCAGCATGGACCGATGCCGGGC
TGACTTCCAAAAAATCCAAATTAGAAAGTCACAGCGACTCACCAGCATGGAGTTTGTCTG
GGAGAGATGAGAGAGAAACTGTGAGCCCTCCATGCTTTGATGAATATAAAATGTCTAAAG
AGTGGACAGCTAGTTCTGCTTTTAGCAGTGTGTGCAACCAGCAGCCACTGGATTTATCCA
GCGGTGTCAAACAGAAGGCTGAGGGTACAGGCAAGACTCCAGTCCAGTGGGAATCTGTCT
TAGATCTCAGTGTGCATAAAAAGCATTGTAGTGACTCTGAAGGCAAGGAATTCAAAGAAA
GTCATTCAGTGCAGCCTACGTGTAGTGCTGTAAAGAAAAGGAAACCAACCACCTGCATGC
TGCAGAAGGTTCTTCTCAATGAATATAATGGCATCGATTTACCTGTAGAAAACCCTGCAG
ATGGGACCAGGAGCCCAAGTCCTTGTAAATCCCTAGAAGCTCAGCCAGATCCTGACCTCG
GTCCGGGCTCTGGTTTCCCTGCCCCTACTGTTGAGTCCACACCTGATGTTTGTCCTTCAT
CACCTGCCCTGCAGACACCCTCCCTTTCATCCGGTCAGCTGCCTCCTCTCTTGATCCCCA
CAGATCCCTCTTCCCCTCCACCCTGTCCCCCGGTATTAACTGTTGCCACTCCGCCCCCTC
CCCTCCTTCCTACCGTACCTCTTCCAGCCCCCTCTTCCAGTGCATCTCCACACCCATGCC
CCTCTCCACTCTCAAATGCCACCGCACAGTCCCCACTTCCAATTCTGTCCCCAACAGTGT
CCCCCTCTCCCTCTCCCATTCCTCCCGTGGAGCCCCTGATGTCTGCCGCCTCACCCGGGC
CTCCAACACTTTCTTCTTCCTCCTCTTCATCTTCCTCCTCCTCTTCGTTTTCTTCTTCAT
CTTCCTCCTCTTCTCCTTCTCCACCTCCTCTCTCCGCAATATCATCTGTTGTTTCCTCTG
GTGATAATCTGGAGGCTTCTCTCCCCATGATATCTTTCAAACAGGAGGAATTAGAGAATG
AAGGTCTGAAACCCAGGGAAGAGCCCCAGTCTGCTGCTGAACAGGATGTTGTTGTTCAGG
AAACATTCAACAAAAACTTTGTTTGCAACGTCTGTGAATCACCTTTTCTTTCCATTAAAG
ATCTAACCAAACATTTATCTATTCATGCTGAAGAATGGCCCTTCAAATGTGAATTTTGTG
TGCAGCTTTTTAAGGATAAAACGGACTTGTCAGAACATCGCTTTTTGCTTCATGGAGTTG
GGAATATCTTTGTGTGTTCTGTTTGTAAAAAAGAATTTGCTTTTTTGTGCAATTTGCAGC
AGCACCAGCGAGATCTCCACCCAGATAAGGTGTGCACACATCACGAGTTTGAAAGCGGGA
CTCTGAGGCCCCAGAACTTTACAGATCCCAGCAAGGCCCATGTAGAGCATATGCAGAGCT
TGCCAGAAGATCCTTTAGAAACTTCTAAAGAAGAAGAGGAGTTAAATGATTCCTCTGAAG
AGCTTTACACGACTATAAAAATAATGGCTTCTGGAATAAAGACAAAAGATCCAGATGTTC
GATTGGGCCTCAATCAGCATTACCCAAGCTTTAAACCACCTCCATTTCAGTACCATCACC
GTAACCCCATGGGGATTGGTGTGACAGCCACAAATTTCACTACACACAATATTCCACAGA
CTTTCACTACCGCCATTCGCTGCACAAAGTGTGGAAAAGGTGTCGACAATATGCCGGAGT
TGCACAAACATATCCTGGCTTGTGCTTCTGCAAGTGACAAGAAGAGGTACACGCCTAAGA
AAAACCCAGTACCATTAAAACAAACTGTGCAACCCAAAAATGGCGTGGTGGTTTTAGATA
ACTCTGGGAAAAATGCCTTCCGACGAATGGGACAGCCCAAAAGGCTTAACTTTAGTGTTG
AGCTCAGCAAAATGTCGTCGAATAAGCTCAAATTAAATGCATTGAAGAAAAAAAATCAGC
TAGTACAGAAAGCAATTCTTCAGAAAAACAAATCTGCAAAGCAGAAGGCCGACTTGAAAA
ATGCTTGTGAGTCATCCTCTCACATCTGCCCTTACTGTAATCGAGAGTTCACTTACATTG
GAAGCCTGAATAAACACGCCGCCTTCAGCTGTCCCAAAAAACCCCTTTCTCCTCCCAAAA
AAAAAGTTTCTCATTCATCTAAGAAAGGTGGACACTCATCACCTGCAAGTAGTGACAAAA
ACAGTAACAGCAACCACCGCAGACGGACAGCGGATGCGGAGATTAAAATGCAAAGCATGC
AGACTCCGTTGGGCAAGACCAGAGCCCGCAGCTCAGGCCCCACCCAAGTCCCACTTCCCT
CCTCATCCTTCAGGTCCAAGCAGAACGTCAAGTTTGCAGCTTCGGTGAAATCCAAAAAAC
CAAGCTCCTCCTCTTTAAGGAACTCCAGCCCGATAAGAATGGCCAAAATAACTCATGTTG
AGGGGAAAAAACCTAAAGCTGTGGCCAAGAATCATTCTGCTCAGCTTTCCAGCAAAACAT
CACGGAGCCTGCACGTGAGGGTACAGAAAAGCAAAGCTGTTTTACAAAGCAAATCCACCT
TGGCGAGTAAGAAAAGAACAGACCGGTTCAATATAAAATCTAGAGAGCGGAGTGGGGGGC
CAGTCACCCGGAGCCTTCAGCTGGCAGCTGCTGCTGACTTGAGTGAGAACAAGAGAGAGG
ACGGCAGCGCCAAGCAGGAGCTGAAGGACTTCAG
gtaagctcaggagctggtgggagggaaagaccgggaaggcgacagtatccttgcctacgg
gtgttttttggtttcttgttgcttttttttttttttttccccacttaaaggaaatagctg
ttgtataagttaaaggcatgaagggtcattgctttggctgcttttagagatgaataaata

 2.05 Intr +  91200  91354  155  0  2   70   55    47 0.061  -0.68
ccagtgagtgctgtcaacgtcagctgctgtcagcatcactattatgactgactgatgtcc
tctctaatctcagtttgaatctgatgaaaagttgagcctggcatgccatgtataagattt
catgacagcgtgagttgtagtagccagaacattccctcattatctcctgcctctgcccag
AGAGAAAGCTCTCAAGTGGCCTGTAACTCCTGGTTTGGCTACCAGTGGCACCAAGGACCT
TTGCTGTGTCTTTGCCAGGCCAGAGCTGTTCCTCTGTGGACCAGAGCTGCTTCCTTCTTA
TAGCAGATGCTCCCACCCATCAGAACTAAAGAGAA
gtgagctgtaagacaagaaatcattttccaattcaaagtgagaaaaaagatgattcattc
ttattctatcaccccctccctgtaactttctatttcttttggttttgaatttcaatgtca
atttttaaaaggtaagttaagaagaaagcatttcattagctctgtcaaaccatgaaaacc

 2.06 Intr +  92345  92462  118  0  1   99   86    49 0.050   5.32
ggtcaacttctcccccttctattttcacagaagtctttccaagccagggttgaccagcag
gtttccatttgtgtagggggagcagttgcccagggtgctgcatagaactggattctgaag
ctgggttcacactcagggaaagagggctggctaagtgacccatgtctgccttgtatgcag
GAAGGCGAGTGGTTCTGGAGTGCCAGGTATTTGCTGCCTGTGATGTCATTGTGTCTGCTA
CTTTTCTGCTTTTTAAAACTACACTGGACTCAATTTCACCCTTCTTTGAGGGTTCAAG
gtaaccatcaattaatactttgttgtagaaaagatgattctggcatataggagatcctga
ccccacactagaggatccagaagcttgagatgtgacttttgagaagagcgtactcctcaa
gatctccttttccatctgtcactcatggatattgtctgtacttcctggcatccttcagat

 2.07 Intr + 104871 104935   65  0  2   80   92    64 0.018   4.36
gccgggcgtggtggcgggctgaggcaggagaatggcgtgaacacgggaggtggagcttgc
agtgagtggagatcgcaccactgcactccagcctgggcgacagagtgagactctgtctca
aaaaaaaaaaaaaaaaaaacagttgatgctgaacttgttcaaccctttcttgatgtctag
GATTGAGGACTACGTATCTCATTCATTTTGCCGGGATTTTATGGAGGAGCATCTTGGGGA
GCATA
gtaagtccattttccctcccctgcactgaacagatttcttggtgtctgagaacagctgtg
cagtgggaatatcacagagtcttgaattgctcatttcttccttccttacatgttgagggt
ctattattcactcacgcacagttaggtactaagaatacaatgatgaacaaaactcaacca

 2.08 Intr + 107947 108167  221  2  2   95   81    85 0.082   6.52
gaggcagtgctgggagcgcacaggctgtccttgtgccagagactctgggctctgccatcc
ctggacaggggccgggcctggggagggtgtgtggtcctgagaccatgtttcctccacctg
caaaccaggggcatccctcatggctgcctccacccacccacccaatatttcctgtaccag
GTCCTGTGCCTGGGGACACAGGGGATTCCACTGTCAGCAAGACTCAGTCCCTGCCCTCAA
AGACATCCTCTTCTAGTGTTGAAGGAGTAAGCAACTCGACAGGCAAGGTGATTGCTGTGG
GAAAAGCTGTGAGCAAAAGGCCCAGAAAGTCACAGAAAGACAGAAGGAAGACAGAAGGGA
ACTCCAAAGGCTATGGGAACAGGGCTGGGGTTGCCACTAAG
gtggggaggtcagagaaggcctctttcaggagacacttaagctgagacccacaaggtggg
agggagctgtgggcagaggagggcagggcaggggaaagccaggcagggagcaaccaggta
agaagagcttggcctggctgagagacaagtgcacagggtgaacacagagtgcgtgagggg

 2.09 Intr + 111120 111150   31  2  1  124   91    15 0.044   3.10
tttggcagcacccctggccttaccttccagatgccggtagcagcacccttccctcaggta
tgaaagccaacgatgtctccacacattaccaagtgtgtaccctgattgagaaccactcat
gtgagctctaccatgtgccagctttgagctggactccattcccgcctcctgttcccgcag
GCAGAGCTGGCTCTGCAAACACCTGGAGCAG
gtagggttccgggcgtgtttgtccctcctgctttcctacctgcctggcctcccacctcct
ctgacctgggccgccttgtccagaggcctccctcactttccattcttccatctagagagg
tagacaggtgacaggctctttgtgcctcagtttcctcatctgtaaattagggataataac

 2.10 Intr + 112773 112916  144  1  0  104   96   -18 0.013   0.85
ggtggttaaagctcatgtcctattagctgatgccaggcacctggcctcaaggtgtccagg
aagtgcaatcctatcctggcctgggaagtggtgaccagcactaaggaagcccccccagca
atgtctagggcaccgggctgggctcctgtgacaatgtgtgttgttcctcttcctgcacag
CTACAGCCTCCGCTTGGCGTCCCGATGCTCTCCACCAGCGGCCCCGTACATCACCAGGCA
GTATAGGAAGGTCAAAGCTCCAGCTGCAGCCCAGTTCCAGGGACCATTCTTCAAAGAGTA
GACACTCTGGCTGCTCCCTGACAG
gtacgaggcaggatggaacagcttctggcactgtttgggtgggtcaagggggtgtgggct
tgggtcttgggtggggagggaaggagagaaagcagtgggtgtgattgcttgtgtgtacca
ggcacggtgcagggcctccctccaggagggcacttagctgagtgcagactccggaccact

 2.11 Term + 119505 119530   26  1  2  111   48    23 0.027  -1.01
gtgccagctctgcaggtgtattcactgtgaacattcatcaagctgtgctttttgctctat
gtatggtatgtttcaataaacagtttagttacaaaattaagtgcaataacgcatggacca
ccatggtcggcactgaatgtgtgcttactgttattatttttattttctttttctcctcag
CACCTGAAGTGACCTGGAATCAGTGA
agccaaagggactggcagtctgccctgcagggagtaccgacctatcccagttgtgtgagg
ctgcgagagaaagggagtgcatgtgcgcgcgtgcatgtgtgcgtgcgtgtgtgttcacgt
gttctcgtgcgggcgcgtgagtggtcttcaaacgagggtcccgatccccggggcggcagg

Predicted peptide sequence(s):


>PRDM2_1|GENSCAN_predicted_peptide_1|198_aa
MPLQEASLPPALYCLTCSVTGGALTNPGLVNSRREKPHFLRKSSQHMFGISRIEVIKQRA
ESRSQAPQGTPAAGVSQYALSLLPLNRIPIATDIFQPEVIQESPIILHILAASVHVLEQR
YLGNAATKRRGRLIAKKYKCKNLGAGDARPSREKYLSLKWKNTSKHKRAINMEMEIQMSQ
VGASGKEIAKRKNIHREG

>PRDM2_1|GENSCAN_predicted_peptide_2|1845_aa
MWKFDVRSEGRGTDLPGPEQVGGPGRPPVGGSGIETAAHFRGFRAPARPARGREPFLPAG
CARRRRQLFAIGAAPARVPPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSR
KGPKEDEEKPSASALEQPATLQEVASQEVPPELATPAPAWEPQPEPDERLEAAACEVNDL
GEEEEEEEEEDEEEEEDDDDDELEDEGEEEASMPNENSVKEPEIRCDEKPEDLLEEPKTT
SEETLEDCSEVTPAMQIPRTKEEANGDVFETFMFPCQHCERKFTTKQGLERHMHIHISTV
NHAFKCKYCGKAFGTQINRRRHERRHEAGLKRKPSQTLQPSEDLADGKASGENVASKDDS
SPPSLGPDCLIMNSEKASQDTINSSVVEENGEVKELHPCKYCKKVFGTHTNMRRHQRRVH
ERHLIPKGVRRKGGLEEPQPPAEQAQATQNVYVPSTEPEEEGEADDVYIMDISSNISENL
NYYIDGKIQTNNNTSNCDVIEMESASADLYGINCLLTPVTVEITQNIKTTQVPVTEDLPK
EPLGSTNSEAKKRRTASPPALPKIKAETDSDPMVPSCSLSLPLSISTTEAVSFHKEKSVY
LSSKLKQLLQTQDKLTPAGISATEIAKLGPVCVSAPASMLPVTSSRFKRRTSSPPSSPQH
SPALRDFGKPSDGKAAWTDAGLTSKKSKLESHSDSPAWSLSGRDERETVSPPCFDEYKMS
KEWTASSAFSSVCNQQPLDLSSGVKQKAEGTGKTPVQWESVLDLSVHKKHCSDSEGKEFK
ESHSVQPTCSAVKKRKPTTCMLQKVLLNEYNGIDLPVENPADGTRSPSPCKSLEAQPDPD
LGPGSGFPAPTVESTPDVCPSSPALQTPSLSSGQLPPLLIPTDPSSPPPCPPVLTVATPP
PPLLPTVPLPAPSSSASPHPCPSPLSNATAQSPLPILSPTVSPSPSPIPPVEPLMSAASP
GPPTLSSSSSSSSSSSSFSSSSSSSSPSPPPLSAISSVVSSGDNLEASLPMISFKQEELE
NEGLKPREEPQSAAEQDVVVQETFNKNFVCNVCESPFLSIKDLTKHLSIHAEEWPFKCEF
CVQLFKDKTDLSEHRFLLHGVGNIFVCSVCKKEFAFLCNLQQHQRDLHPDKVCTHHEFES
GTLRPQNFTDPSKAHVEHMQSLPEDPLETSKEEEELNDSSEELYTTIKIMASGIKTKDPD
VRLGLNQHYPSFKPPPFQYHHRNPMGIGVTATNFTTHNIPQTFTTAIRCTKCGKGVDNMP
ELHKHILACASASDKKRYTPKKNPVPLKQTVQPKNGVVVLDNSGKNAFRRMGQPKRLNFS
VELSKMSSNKLKLNALKKKNQLVQKAILQKNKSAKQKADLKNACESSSHICPYCNREFTY
IGSLNKHAAFSCPKKPLSPPKKKVSHSSKKGGHSSPASSDKNSNSNHRRRTADAEIKMQS
MQTPLGKTRARSSGPTQVPLPSSSFRSKQNVKFAASVKSKKPSSSSLRNSSPIRMAKITH
VEGKKPKAVAKNHSAQLSSKTSRSLHVRVQKSKAVLQSKSTLASKKRTDRFNIKSRERSG
GPVTRSLQLAAAADLSENKREDGSAKQELKDFREKALKWPVTPGLATSGTKDLCCVFARP
ELFLCGPELLPSYSRCSHPSELKRRRRVVLECQVFAACDVIVSATFLLFKTTLDSISPFF
EGSRIEDYVSHSFCRDFMEEHLGEHSPVPGDTGDSTVSKTQSLPSKTSSSSVEGVSNSTG
KVIAVGKAVSKRPRKSQKDRRKTEGNSKGYGNRAGVATKAELALQTPGAATASAWRPDAL
HQRPRTSPGSIGRSKLQLQPSSRDHSSKSRHSGCSLTAPEVTWNQ