GENSCAN 1.0	Date run: 14-Jan-104	Time: 18:52:12

Sequence PIP5K1A_1 : 53333 bp : 45.24% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   2388   2440   53  2  2   81   75    94 0.760   8.03
gaccctgtctcaaaaaaaaaaaaaaagaagttgcggtaggaaacaagagaaacggaaggg
agtagagaaactaagaaagtaaatggaggcctaagaagtagagagaactacttagtgtga
gaggcaggtggaatctaagttgattgtgggctaattggatgaaaatgttgaagagaagcc
ATGGGACTTAAAAGATATCGAAAAGTTATTGGACGCTTTCGATTTCTGGAGAG
gtagggaatcgtgaattttgttgggtgggcgggagttgttgaagccatcttttccctcag
atactcccccctaatgtgtcaccccttctcacttcgcacccccacccttagggccgcaca
ggcacacagacacacatacatactttctcagactaattcctttggtgattcccaactcta

 1.02 Intr +  20716  20843  128  1  2   41   84    66 0.695   1.82
accatgtccggctaatttttgtatttatagagatgaggtttcaccatgttggccaggctg
gtcttgaattcctggcctcaggtgatccactgcccaccttggcctcccccaagtggtggg
attgcaggcgtgagccactgtgcctggcagtgttaaaattgttaatgtcttgttacaaag
ACAAAAAGGTATTTTCTATGCTAGTGAGGACCTTAACGTCTGTAAAACTGTGAAACTGCG
CTTTCAAGTATCAGACTTGAAAGTTTCTGCTCCTCTAGAATACTGGCATTGCCTAATTCA
GAACAAAG
gtaatctccctaaaagaaaggtactttcatattctttttgcaaatgatgttgatgaatgt
tgctagaggaacagtgttgttaatttccttgagaggacctgaaggaggacaactgtactc
ttaatcctatcagtgaaaatgaaacatttccttgtctcaaggaaaaagggggtaccttga

 1.03 Intr +  26850  26884   35  1  2  121  105    31 0.958   6.04
agtatggagaaggagagagggacatacacagttgctatccaaaaggatctggtattactg
agcaagaggcaggagtttatacttatgtttagtttgactcaaactctgatggtttcagta
tgcttgacagagatgtgagtgtgtgatacactcttatgattgtttttttttcccccctag
CAGCATCTGGAATCAAGAGACCCATGGCATCTGAG
gtgagtttcatactgatacaatggttactaaaaccttaattctgggatagaaggaacctg
tttatgacatttttattttttctctacttaggtcttggaagctagacaggattcttacat
ctcattggtaggctagaaattatgcaactcatcttttattgtagtttattttaaatatta

 1.04 Intr +  29925  30005   81  2  0   96   93    27 0.931   3.83
attcattgggaaccaacattatagctgtatatttgcatgggatagatctgaagattttgt
aaaatgtttttaatctagaaagaatatgttgtttcagtttattttgttttgatgtaccat
tgtggtagctatttggtgtcttacatgggaattgtattataatcttgactcttcttctag
GTGCCTTATGCCTCTGGCATGCCCATCAAGAAAATAGGCCATAGAAGTGTTGATTCCTCA
GGAGAGACAACATATAAAAAG
gtgtgtctggatgaaaccgtctcatcttactccaggagctcagcagcttactctgggaac
tcagtctccttgaaattactctccatgtactgtcctgtttcttgatctcctaagcttttg
cacataatacagcttagactttagatttatttctcaaagggtaaattgtctcctttttgt

 1.05 Intr +  34276  34406  131  0  2   89   92    84 0.999   8.39
ttaattgcagagtacagcatagggatggggaaactggattgtcccagttttatctgaact
attgctcagactaaaggatgtttgttttaaagtgttccttctagcttcccctttctgaat
ttttattgttatgatcctacttatactaggaattttcttctcatttctcttgtttctcag
ACAACCTCATCAGCCTTGAAAGGTGCCATCCAGTTAGGCATTACCCACACTGTGGGGAGC
CTGAGTACCAAACCAGAGCGTGATGTCCTCATGCAAGATTTCTACGTGGTTGAGAGTATC
TTCTTTCCCAG
gtacagagtttaatgttcaggagcatgtcctggaaatgtggccttttcaaatcagcccag
ggcagttttaggggttcaggtcggacaatttagacatgtgtccatttcttaacctggtta
caatcagggcgatgtgggactagagagttcggagagcagatactgtcctctagatgcttc

 1.06 Intr +  34853  34970  118  2  1   65   99   172 0.999  16.47
tcttgctgtccatgctgtgccattgtctcactaactcatctaagaagggctgtgattatc
ttaggaggaatgtattcccccactccccccaccatgaggtgactctgagtgtcttcgcaa
ggtagattctctggatgatagggactggcaagttatggctacctctgtttaaccccacag
TGAAGGGAGCAACCTGACCCCTGCTCATCACTACAATGACTTTCGTTTCAAGACCTATGC
ACCTGTTGCCTTCCGCTACTTCCGGGAGCTATTTGGTATCCGGCCCGATGATTACTTG
gtaagcatctggatatcaggacactgtgactccagtatcagagggatattcccaaaggaa
ggccccttttctccacagtctcgctctggtttttatttagaaaagaattgcatctgtagt
tgatttttgtgttgggcaaggccctgatgtgtctaaatctcttagttcttctctgtttgc

 1.07 Intr +  35156  35308  153  1  0   78   91    90 0.994   8.57
catctggatatcaggacactgtgactccagtatcagagggatattcccaaaggaaggccc
cttttctccacagtctcgctctggtttttatttagaaaagaattgcatctgtagttgatt
tttgtgttgggcaaggccctgatgtgtctaaatctcttagttcttctctgtttgccccag
TATTCCCTCTGCAGTGAGCCGCTGATTGAACTCTGTAGCTCTGGAGCTAGTGGTTCCCTA
TTCTATGTGTCCAGCGACGATGAGTTCATTATTAAGACAGTCCAACATAAAGAGGCGGAA
TTTCTGCAGAAGCTGCTTCCAGGATACTACATG
gtaagggagagagaagcactgtccacctgtgctgctcacttctgggcaaggctggggagg
ctgtcttcagcagggtaaaacagtgtcagcacttctatcttaagagtgtagttcaggcca
ggcacggtggctcatgcctgtaatcccaggactttgggaggccgaggcaagaggatcaca

 1.08 Intr +  36802  37101  300  0  0  103   97   255 0.994  24.83
cttaccattgaaatagatgcatagggaaatgtaaagcatatatgatgtaggtttatggac
acattgtgtctaaatctcatataggagataaagggaggatgggtggtaacttttactggt
gagtttcactgaaaatcagctaagttgttctcctacttctgtttccttttgtgttctcag
AACCTCAACCAGAACCCTCGGACTTTGCTGCCTAAATTCTATGGACTGTACTGTGTGCAG
GCAGGTGGCAAGAACATTCGGATTGTGGTGATGAACAATCTTTTACCAAGATCGGTAAAA
ATGCATATCAAATATGACCTCAAAGGCTCAACCTACAAACGGCGGGCTTCCCAGAAAGAG
CGAGAGAAGCCTCTTCCCACATTTAAAGACCTAGACTTCTTACAAGACATCCCTGATGGT
CTTTTTTTGGATGCTGACATGTACAACGCTCTCTGTAAGACCCTGCAGCGTGACTGTTTG

gtgagtttgttacttagacatcaaaaatctcagttactaaaacagcttgattgttcttag
gcattaagtttgtgggagatggaactctgttccttagcactgtatgtcctgggctgtatt
taaaataagtcttaattagttcattgccattcctttacatttttactttctccccgttta

 1.09 Intr +  39163  39368  206  0  2   83  100   126 0.988  11.30
aagtaggtggatattttgagcctgggaggttgcagctacagtgagccgagatcacaccac
tgcactctagcctgggttacagattgataccctttctcaaaaaaacaaaaaaattgtgag
atcctgaaaaatatttttatttcttccaaggctcagatcatgtttttttccttccattag
GTGCTGCAGAGCTTCAAGATAATGGATTACAGCCTCTTGATGTCAATCCATAATATAGAT
CATGCACAACGAGAGCCCTTAAGCAGTGAAACACAGTACTCAGTTGATACTCGAAGACCG
GCCCCCCAAAAGGCTCTGTATTCCACAGCCATGGAATCCATCCAGGGAGAGGCTCGACGG
GGTGGTACCATGGAGACTGATGACCA
gtaagtgggctcagggccactaggggggagaacataggcccacagcacttttcttttctt
ttttttttttttttttttttagtttcactcttgttgcccaggctgatgtgctgatgtgca
atggcacgatctcagcctactactacctccacctcctgggttcaagcgattctcctgctt

 1.10 Intr +  40787  40870   84  2  0  100   94    36 0.951   4.34
atctcattttctcctgtttttttaatgtatttttttctctttttgttttcttgatcactt
attatctgaccttctggtttatggaggatgaggcagttatgtgtaggtttcacttcccca
tcctgatctgactaaactagccaacagattttctcaccctttcctttttgccttttccag
TATGGGTGGCATCCCTGCCCGGAATAGTAAAGGGGAAAGGCTTCTGCTTTATATTGGCAT
CATTGACATTCTACAGTCTTACAG
gtgaggagcatatggatcccaaattaagagagggtggatacagataaccagtcacgtttc
tcttttagataggtttgttaccaagttcttccggaagcaagaacagtgagttgcagtctg
gctacttacttcattagttttcagatggtttatttccttgattttgcctctttccccggc

 1.11 Intr +  41735  41783   49  2  1   83   83    24 0.889   0.08
ctgtgatgaaccagcactgccatgcctgttcttgggaaaaccagtgtaccagtagatgtg
ctttctcagcttctgtcttttcaagattttctattacccctttaaccccctaaaatataa
agttattaaggtcatttatttaaaaatgacgtgagtaggtgatgtacatttttcttgcag
GTTTGTTAAGAAGTTGGAGCACTCTTGGAAAGCCCTGGTACATGACGGA
gtaagtagtaatactagaggctctcttaccgtacacttctgcctccatcacttctgattg
gcctcagtttcttgcaattttttcttttttcttttttcttttttttttttttgagacagg
gtctcactctgtcacccaggctggagtgcagtggcgtgatctcggctcgctgcaacctcc

 1.12 Intr +  42560  42644   85  1  1  125   95   107 0.993  14.49
acctcagcttcccaaaatgctaggattacaggtgtgagccactacgtctggccccttccg
tttatttcatctgtaggttttacccttctgctaggggctcagtctgggggaagatggccc
ttggactagagttcctcttgccgggcctcctaactctatagcatttcttctgctctgcag
GACACTGTCTCAGTGCATCGCCCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGC
AACACAGTATTTAAGAAGATTCCCT
gtaagtggtttctaccaattgactgcctactcctgcccagtggctcccttaccccaagag
aacagagggcaggacacctctggtagggagctgccaatgccagaggcctctccttccacc
tacatcccatgagagccatttcttgtcctttgtgttagtctgtcatagtcatttccaagt

 1.13 Intr +  45043  45172  130  2  1  106   81    30 0.737   3.85
aagtggagccaggtcagcgctagggctggggtccccatgtgattgggtactccctccctt
ccttctgagcctttatcttgtctggccaggacctctgctcccatttctatccaggaagcc
tagctgctacatatttttccttgtatttactgtaccccatcttctctatcttttttccag
GCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAGACTCCACCTTTGGAGGAAATCAGTG
AGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATGC
TAACTACAAG
gttggtttattggcccctttctccatataatcttatctctcttttcaagtccttggaaac
ctctataatttgattgcatcataataaattaccccaaagattagtggcttaaaataacaa
acatatatcatactttctgtgggtcaggaatccaggcccagcttagctgggtcctctggc

 1.14 Term +  50468  50552   85  2  1   90   38    70 0.212  -0.67
caaagtgctgggattacaggtgtgagccaccatgcgcggccgccatcttgttttttaaaa
aatatttttggtacctcatacttggaggctgaggctgaaatagaaatttcttaacgcttg
aattccatttctgcttaatctcatactccacatccttaactttacactctcccttttcag
TAAGCGCAAAGCCTCAGAAGACCTGGAACAAGATTCTGCCATCTCTGTGATCCCAAGATG
TCAGCCCTTGCCCCAGCAATGCTGA
attttcttctacttggtcatcaaaaaaggagtgtaatagaagtgaggggagctgctcctc
catcttcttcctgaagaagaaccttctctccttcctcttcctcatgaatgggccttagtg
cctcagagagttgaggaccgcagcatcccctccactccagagttgggtggtatggatttt

Predicted peptide sequence(s):


>PIP5K1A_1|GENSCAN_predicted_peptide_1|545_aa
MGLKRYRKVIGRFRFLERQKGIFYASEDLNVCKTVKLRFQVSDLKVSAPLEYWHCLIQNK
AASGIKRPMASEVPYASGMPIKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSL
STKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDD
YLYSLCSEPLIELCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPR
TLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPT
FKDLDFLQDIPDGLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPL
SSETQYSVDTRRPAPQKALYSTAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYI
GIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPCVHLGR
PDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSKRKASEDLEQDSAISVIPRCQP
LPQQC