GENSCAN 1.0	Date run: 14-Jan-104	Time: 18:13:49

Sequence PGBD5_1 : 58374 bp : 48.64% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1324  124  0  1   52   92    72 0.222   4.33
agtgcttatcccaaatgtatgagccggatgctgcactgtgctttatgcacagtatttcat
tttattctcacaatgactctttgaggtggatactctaatctttgccattttacagatggg
gaaatgaaggctgtgtgggattatgtaccttgaccagggcacctgttcggtaggtcagat
ATGCCTGACTACAGAACTCGAGCTCTCTTCGTGCAAAGTACTCTCGGGGACTCTGCAGGA
CCTGAGCTGCAGTTGCTCAGCATAGTGCCCGGCCGGGATCTGCAGCCAAGCGATTCATTC
ACAG
gtacagctgtcttagtaaggcccttccagctctgggcaagagatcttttcatccatgtgt
tattggcatcttcatcatcatcatcacagcttctgcctttatgaaggatttatcacgtgt
tgatgtcagcatttcacctggatggccattgcttctttgtgcctatgacagtcactgctc

 1.02 Intr +  10678  10869  192  2  0  120   50    25 0.262   1.36
gcacactcttcccggttgctttttggggaggggccacttggcctcagcaacacacatttc
taagaatttattttaggcatggaaaaaatcccaagtccatgtatatttcagtggtcagct
ttcagcttttatccatctccccaagccttctctctcctccaccttattcctcctccgcag
CCTCCTCCTCACCACCACCATCTGTGTGGTCAGAACTTGAGCACATCCGTGGAAAATCAG
AAGCAACCACAGAGCTAAAAAGACCCAGCCTTCCAGGGAGTATTCATTCCTGCCTATGTG
GGGTGTGGTGTGGCGTGGGGAAGAGAACCCCCAGCTCCTTGGTGTCCAGCTTGCAGGACC
TTGAGCTCCTTG
gtgtgccagcttgcgtgaccttgagcaagttctcttccccgagcctctgcattcacctgc
agagcgggagtctggtagccctgtgcttggctgttgcgagaatgaaattggacgcgagaa
tgctctttgtagtggttgatatgatgaagagcctccacggagtatgccggagtgtttttt

 1.03 Intr +  16445  16549  105  0  0   76   57    43 0.034   0.19
gagatgaagaagctggcctgggggtcaggaggttcccccagaaggtgatgcttcatgaag
ctggagccccaggagggcttccttccaggaggatcaggccttgaggcgggaaagagcttg
ccacggtccaggtctgacacaggcttccccggcaagcctccacaactgtctgtcatccag
GCCAGAGGCAGCGACAGCTGTGGATGGAGTCGACGCCTCGGCCGCCCTATAATCCATTCC
TCGTGCCCTGCACACCCGTGGGGAAACTCAGTGCAGAGCATGGAG
gtgaaggagctggtagaggaagctaaatcccagccaggtctcacctgatttggggaacag
ccatcagatcctcccccaccctctcgtgcagcagagtgagcctgctgaagttgcaagagc
atggtcacgtggtgctcacagcccttcactggcttcccgcgcccttgggcaagtgtgagc

 1.04 Intr +  21501  21928  428  1  2   86   94   780 0.149  71.91
ggagccggcactgtcaggtggttgcagcagcttctggaaggttggaggggaaggcggtag
cactggaggcagcgggggcactcggccagggacccagggattggaaatgcagccgttctc
gtgtcgagtcagggtgtggcggccgtcctaaggaacactccacctgtctttgggtttcag
GTCCCACCCGAAAGATGCCCCCCAGCGCCAGTGCCGTGGACTTCTTCCAGCTCTTTGTCC
CAGACAACGTCCTCAAGAACATGGTGGTGCAGACAAACATGTATGCCAAGAAGTTCCAGG
AGCGGTTTGGGAGCGACGGAGCCTGGGTGGAGGTGACGCTGACGGAGATGAAGGCGTTCC
TGGGCTACATGATCTCCACCAGCATCTCCCACTGCGAGTCCGTCCTCAGCATCTGGAGCG
GAGGCTTCTACAGCAACCGCAGCCTCGCCCTCGTCATGAGCCAGGCCCGCTTCGAGAAGA
TCCTCAAGTACTTCCACGTCGTGGCCTTCCGCTCCAGCCAGACCACGCACGGGCTCTACA
AGGTCCAGCCCTTCCTCGACTCCCTGCAGAACAGCTTCGACTCTGCCTTCAGGCCTTCCC
AAACCCAG
gtgaggcccacgcaggacgtaagagcttgtccaggtgtcctcgctctctcggcctagcct
tgtctgttggcagggctttggggtgtccttcctgccctgcctgccctctgagttcacttc
aaggtcacctctgctattcttccattccattaatccacataatccaaatgagatcggagg

 1.05 Intr +  26345  26377   33  1  0   74  115    12 0.646   0.92
ccttcacaagacaggggagaccacatgtgatgtccccatgtgtccattagtagaaaaact
gaggaggcagatatgcactgctaagactgaacagtgcagggctgtcacttttcgaaaatt
gaatgcacggtaaccttgcattcaatttgcattcaacctcagcccaccttccattcctag
AAGAATGGAAGGCAGCTGTCCACATCACACATG
gtaagtatcatcctcccttctgtccttggaagacctttttctgccatcacctgggagctt
gttgggaatgcacagtctcagacccggcctcacagaatcacaatccacattttagcagga
tcctcaggtgactgatttgttcaaactttttctgtaaatagccagatggtaagtatttag

 1.06 Intr +  27730  27864  135  0  0  114   99   190 0.997  23.46
tagtatagataatgataccaccctcctatagataagaagggtcaggatcagagaggtaaa
gtaacttagttaaggtcacagagctgctcaaatgcagaggctgaatttgagctccaatct
gatgagccctcaagctcatgctgccttccgtgagagcctctgctttttccctcctggcag
GTGCTACATGAACCCCTGATCGATGAGGATCCTGTATTCATTGCCACGTGCACAGAGCGG
GAGCTGCGAAAGAGGAAAAAGCGGAAATTCAGCCTCTGGGTCAGACAATGTTCTTCCACT
GGCTTCATCATCCAG
gtgagccctgggctgagcccggggagggtcggtgaagagggtcggggaagaaaatccggg
cgacttgggctcatctgatacccaagaacttgttcacatacccttttcactgtgggtcca
agtccacccagatgctcctgcggaggccagggctgggctgctccctcctcaccgaggcag

 1.07 Intr +  30049  30103   55  0  1  122   48    41 0.622   2.05
agctgacaactcccagtcaaaagcagcgtagcttccaccattgccaggggcagccctcaa
aatgtgctcagaggtgcagagccaaggaggcaattaattacccttcagtttcaggctgtg
ccgtgacaggactggcatgagaactttctcagcccccgcagtccctctctttgttcctag
GTCCAACTGAAGGTGCCTGTGGCAGGCACAGCGCAGGGAAAGGACATCTCTGCCT
gtgaggggccaggagacgtagaggagccacatgacccggggacagttgtttttttagagt
cctgccccttttcttggttctccaggtgctaatcttggtttgacagcttttgaaggtcag
cagcctgggcaagcacagccctggggcagaataataccttacaccgtcagagctttcaca

 1.08 Intr +  30189  30313  125  1  2   90   52    27 0.079  -0.40
gaactttctcagcccccgcagtccctctctttgttcctaggtccaactgaaggtgcctgt
ggcaggcacagcgcagggaaaggacatctctgcctgtgaggggccaggagacgtagagga
gccacatgacccggggacagttgtttttttagagtcctgccccttttcttggttctccag
GTGCTAATCTTGGTTTGACAGCTTTTGAAGGTCAGCAGCCTGGGCAAGCACAGCCCTGGG
GCAGAATAATACCTTACACCGTCAGAGCTTTCACACTGCAGTTCCCTGATCCTCCCCACA
GCCTT
gtaagacatagagagcaggccgtgttgatcccatttcttacatgaggtggctttggctca
caggggttacctgccagacagctggtcagcacagagctggcttctcccctgggcctcaac
ctgcctcttccctcgtccatccccaaggcataggcagcccctgctcttgcatttacctcc

 1.09 Intr +  41534  41714  181  1  1   77   96   252 0.956  24.34
aggccacggggtgtgcttgggggtgacctagagtccctgtgagctgaaaagatgatgggg
gcttttccatgggctcccaactggatgactgagacccatgagatctgtgcttgctgaata
ctcgggctcccagcctgacactgctgtgagcacgctaacctctgtgtgtttctgttaaag
ATTTATGTCCACCTGAAGGAAGGTGGGGGCCCAGATGGCCTGGATGCGCTGAAGAATAAG
CCCCAGCTCCACAGCATGGTGGCCAGGAGCCTGTGCCGGAACGCGGCAGGCAAGAACTAC
ATCATTTTCACGGGGCCCAGCATCACCAGCCTGACGCTGTTTGAAGAGTTTGAGAAGCAA
G
gttagtcaagtggggagccagtgaggatacggcccagcctcccctgggaaagtggtggga
gaggtccaggtgggggtgcagatacgtggtggccaccacaaaccacaggatgccaggtga
tgaggcccttccttgagggaacagatgcgtctcagccaccctgtgtgctggatcccgctg

 1.10 Intr +  45781  45978  198  2  0  102   96   287 0.982  30.22
ggatacgagacctcaaaacttcagcagtctcttctagaggggtctctagagggtctgact
cccaagcatcagcctcagaaccgggcagtcccgtcctttccttgggggtgcccagggcgg
aggagccgccggcatctccgatggtggtgagtgtgcgatccttcctccctctcccctcag
GGATTTACTGCTGCGGCTTGCTCCGCGCGCGGAAGAGTGACTGCACCGGCCTCCCACTGT
CCATGCTGACCAACCCAGCCACACCCCCGGCCCGGGGCCAGTACCAAATCAAGATGAAGG
GGAACATGTCCTTGATCTGCTGGTACAACAAAGGACACTTCCGCTTCCTGACCAACGCCT
ACTCCCCGGTGCAGCAGG
gtgagtgcgggtccgccattgacacagtggggcgcgcggggattggttgagcttggccga
gcccaccgctgcggtggatgtggcgtccactgtgggctgtgctgctctggggtcagacta
ccctcggttattccccagcatctggggccacgctcctaagtgtggcggctgtgtggaagc

 1.11 Intr +  46117  46195   79  2  1   75   55    60 0.485   0.01
acttccgcttcctgaccaacgcctactccccggtgcagcagggtgagtgcgggtccgcca
ttgacacagtggggcgcgcggggattggttgagcttggccgagcccaccgctgcggtgga
tgtggcgtccactgtgggctgtgctgctctggggtcagactaccctcggttattccccag
CATCTGGGGCCACGCTCCTAAGTGTGGCGGCTGTGTGGAAGCAGCGGGGAAGCAGCGAGG
AAAGAGCTCCCTGTTCGTT
gtaagcttttgagcggtgcatgctgacggggtttgcaggtggctcaagccaccacggggt
atgataatggctgcatttgaatggcatttcactttgtcgtctgggattctgtgaaaaatc
cgttctgatggaaggaaaaatccaccattcttatctttcaacgtcttccttagaagtaaa

 1.12 Intr +  51311  51413  103  2  1   99   66    75 0.401   6.58
tctgcaggctcccgacagcagaacatctctcaggaggaggggctccataagcaagtgaag
gaggccatagtcttccggccaggaggaagctccagtgtgggggccgccatggttttctgg
cccttggatagctttaggaaactcattgccagggccccttccccggtcctgcgtctctag
GGCAGGCCTTGGCAGCTCAATTTCCCACAAGCTGGCCAGTGTTTCTTCCATGCGAAATGC
TGCTGTTTCTGAGGAAAGAAGGAAAGAGTCCGGCTCAGTGTAT
gtaagcagatctgcgcgaccctggtctcctcagccacggtccctcagtgagagttgtggg
ggtgggagggggctggccccagatgaagctcctgtggacctgcaaaggacatgcccgttt
gactttgaccttgtccatttaagtattgctgaaatttcacaatcctgtgagccaatgcct

 1.13 Intr +  53239  53368  130  0  1   64   38    17 0.251  -5.43
ctccgctttcactctttcaaggcccagtcggatgcagcacccttccccatgctgcttaga
gccccttcaggcctgccaggatcctagaggcctgtaaaccccatgacttggggtgctgtg
tctgggccagcgcataccatggcactcacctgactgatgctttcctcaatccctctgaag
CACCTGGTGGTTGGTGCTGATTGTTCTTCTTCAACTCTTCCCTCCCCTCCTCCTCCTCTG
CTCATTATTAAGTTGGGAGCAGCTAAGCTGGACGAAGATAGGCACATTTATAAAGTGGCA
TTAGGAGGAG
gtgctgaggaaggggcttatcttgtctctcgccttcaggagtcatcatcaaaaggaagag
tggggagatcccatgccccttggccgtggaggcgtttgccgctcacctgagctacatctg
cagatacgatgacaaatacagcaagtaagtggctgggcacctccatgacagaagggctct

 1.14 Intr +  53407  53512  106  2  1   82  108   132 0.999  13.87
atccctctgaagcacctggtggttggtgctgattgttcttcttcaactcttccctcccct
cctcctcctctgctcattattaagttgggagcagctaagctggacgaagataggcacatt
tataaagtggcattaggaggaggtgctgaggaaggggcttatcttgtctctcgccttcag
GAGTCATCATCAAAAGGAAGAGTGGGGAGATCCCATGCCCCTTGGCCGTGGAGGCGTTTG
CCGCTCACCTGAGCTACATCTGCAGATACGATGACAAATACAGCAA
gtaagtggctgggcacctccatgacagaagggctctcatagttgtgccgtctcggaagag
atgtaatggcagatgatcactagtttccccagtgtaagaactgcaggatgaagaccctgg
gaggtaagatcctgccctcagcctgggcttctgggcctcgcctgtgcacacatggcttta

 1.15 Term +  55202  55397  196  2  1  107   44   334 0.955  27.78
aaacccccagctggaactcacctaacatcccaagcctgactcctgcccccatagccctcc
tgcttctgtcgggggcgaacctgcagcgtctcacgggctgtggtgagggggggcctttgg
gatgcatctccgggtgccatgaaccatcgggtcagccgttcttattccctctgtcctcag
GTATTTCATTTCTCATAAACCAAACAAGACCTGGCAGCAGGTGTTCTGGTTCGCCATCAG
CATCGCCATCAACAATGCCTACATCCTGTACAAAATGTCAGACGCCTACCACGTGAAGAG
GTACAGCCGGGCGCAGTTTGGAGAGAGACTCGTCAGAGAGCTGCTGGGCTTGGAGGATGC
CTCTCCGACCCACTGA
tgctgggggcgcaggactcggtcaagggaggggcaagaggaggaggagagcctgccgttc
caacttgcccatcagagacccggacacggcctggtgtgtggcttgctgcctgggagggat
gcacagggcctctggagggacaggatggacctggtcagaggacggttgctgtcctcattt

Predicted peptide sequence(s):


>PGBD5_1|GENSCAN_predicted_peptide_1|729_aa
MPDYRTRALFVQSTLGDSAGPELQLLSIVPGRDLQPSDSFTASSSPPPSVWSELEHIRGK
SEATTELKRPSLPGSIHSCLCGVWCGVGKRTPSSLVSSLQDLELLGQRQRQLWMESTPRP
PYNPFLVPCTPVGKLSAEHGGPTRKMPPSASAVDFFQLFVPDNVLKNMVVQTNMYAKKFQ
ERFGSDGAWVEVTLTEMKAFLGYMISTSISHCESVLSIWSGGFYSNRSLALVMSQARFEK
ILKYFHVVAFRSSQTTHGLYKVQPFLDSLQNSFDSAFRPSQTQKNGRQLSTSHMVLHEPL
IDEDPVFIATCTERELRKRKKRKFSLWVRQCSSTGFIIQVQLKVPVAGTAQGKDISACAN
LGLTAFEGQQPGQAQPWGRIIPYTVRAFTLQFPDPPHSLIYVHLKEGGGPDGLDALKNKP
QLHSMVARSLCRNAAGKNYIIFTGPSITSLTLFEEFEKQGIYCCGLLRARKSDCTGLPLS
MLTNPATPPARGQYQIKMKGNMSLICWYNKGHFRFLTNAYSPVQQASGATLLSVAAVWKQ
RGSSEERAPCSLAGLGSSISHKLASVSSMRNAAVSEERRKESGSVYHLVVGADCSSSTLP
SPPPPLLIIKLGAAKLDEDRHIYKVALGGGVIIKRKSGEIPCPLAVEAFAAHLSYICRYD
DKYSKYFISHKPNKTWQQVFWFAISIAINNAYILYKMSDAYHVKRYSRAQFGERLVRELL
GLEDASPTH