GENSCAN 1.0	Date run: 14-Jan-104	Time: 19:25:14

Sequence OSBPL9_1 : 173772 bp : 39.02% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1220   1330  111  1  0  105  113   147 0.887  19.16
agtcctacacacaataggcgccctaagaaagcgtgtttgacttgatcgctggagcatctg
ccggcaccgcccaggacccgcccaggacccgccccgccccctgcggccccgccccccgca
tgctgaatgccatataggcgagtgacgtcaggccgtttgttgtcattggcggctcccaag
ATGGCGTCCATCATGGAAGGGCCGCTGAGCAAATGGACTAACGTGATGAAGGGCTGGCAG
TACCGTTGGTTCGTGCTGGACTACAATGCAGGACTGCTCTCCTACTACACG
gtgagtccttggagggcacagctccaggcgcctcggggccgcgtttcctgggtggaggtg
ggggaccggggttttaggtggctgagttgaggttgctagtctgggggtgccgccgtacgc
gagggttcccttgttggggagggttttacgtctcggatagccaatgagggtgagggagag

 1.02 Term +  32485  32694  210  0  0   54   42   127 0.328   1.01
cctttctttcattaccagaagctactaggattcatcagaaataacctaatatttggtgaa
tggcattggcttagacagatttgcttcagaccaggaggtagctgaagatcactggcagct
gggactttcctccttatctctgtgcttctcttgctgtgtaggcttgctttcttcgcatag
AAGGCACAGGACCAGTGGCCTCTGTACCTCACAGCTTCAAGAGCAGATAGGAGGGAGCTC
TTCCCTTTGCCCCGGTTGAAAAACTTCCTGGGAGATGACTCTGTCCTGCCCTGTGGGGTA
GTGGGTCCTGTGATTGGTCAGCTTCCTTTATCAGAAAAGGCTGTGTCTGGTGAAAGCAGT
CACACCAGCTTCCCTATAGCCCCGCATTAA
agctgagtggagagagggagggagagggccctgtgctattgtgaaagaggataatttgat
gctattacagctcagataaggtctgggagaatgatttgccggacaggcatctccaactgt
gcaactcagccacattttacatatgtaacactgggtaacttacttgatatccctagtgtc

 2.04 PlyA -  34380  34375    6                               1.05
 2.03 Term -  39657  39361  297  0  0  -17   52   278 0.872   7.98
 2.02 Intr -  39953  39817  137  0  2   58   76   136 0.779   8.77
 2.01 Init -  53505  53340  166  0  1   57   88   106 0.120   7.34
 2.00 Prom -  54169  54130   40                              -6.15

 3.01 Init +  58630  58690   61  0  1   41   82    70 0.202   3.16
cagggctggtcttgaattcctgggcccaagcaatcctcctgccttagcctcccaaattac
tgggatttcaggtgttagccattgtgcctcactgtcagcatctgaaatagagaatatagg
agagcagaggtagtggtgagggacctcttatgtttaaggtgtctgtgggacacatagatg
ATGGTAATTGGATCTGAGTCTGGGCTGGAAATGGAGATTTGTGATCGTCAGCATACTGCT
G
gtaggtagaactagaagttgaaaatatgaatgcctaacggctaggcagataagtacagtc
aagtgctgcataaggacatttaggtcaacgatggaccacatatatgatggtggttctata
agattataataccatatttttactgtactttttctatgtttagatacacaaatacttacc

 3.02 Term +  71972  72183  212  0  2   24   47   198 0.826   5.77
agaagtgtcctatattttagaatacacgggaggtgaggagaaggaggcttgagttgagct
ggaactagatagatcatcaaagatctcatacaccagaatgataggttaaaacaccttttc
tgtaaattaggaaagggcaattttagtcagggaagcctcctcgtcacatttgtggctcag
AGGGAACACTAGGAACCAGAGTGAAGAGAAGTGAGATTGGAGACAAGGAGCCTAGTGTGG
AGCTTACTGCAGAGGCTCTGGTGAGAGATGGTGAAGGTTTGAACCAAGGCAGTAACGGTG
GTTGCTTTTACTTACACAGGGTACATCCTGATTGTCAATGGATGGACTATGAATGGAACA
TGACTATTCGAAGTATAAAAATTGACGCTTGA
ccatgttctctctgtgggagtttttaggtagcttacaaaacttttgaggaatttacattt
tcaactaatgagataaatcagggtaatgccataaatgcaatgtgcagttgaattttagca
atgtggacaggttggttcatggtagagagaagtgaatctgagccatagcctatctgaaaa

 4.09 PlyA -  73282  73277    6                               1.05
 4.08 Term -  76083  75920  164  1  2   37   47   197 0.640   7.62
 4.07 Intr -  80349  80289   61  0  1   88   81    29 0.767  -0.41
 4.06 Intr -  87634  87335  300  1  0   11   86   141 0.028   2.21
 4.05 Intr -  88024  87901  124  0  1  -32   55   129 0.026  -2.73
 4.04 Intr -  91394  91248  147  1  0   27   83   145 0.113   6.33
 4.03 Intr -  91766  91396  371  2  2   42   41   354 0.144  19.08
 4.02 Intr -  92111  91901  211  1  1   65  -22   115 0.320  -3.81
 4.01 Init -  93725  93211  515  2  2   37  100   332 0.373  23.72
 4.00 Prom - 104322 104283   40                              -5.45

 5.01 Init + 112244 112256   13  1  1   71   78    -4 0.093  -2.62
gaggaaatgatgatgagtagaagtaaataagtgaagtgtggggattgatgtcaaggggac
agtataaaagaaataacagcatgcgccaaggccctaaaattggaaagtccttggcaaatt
aaaggagtttgaaaaaggccattgtgtgcaaagcagaaaataggtactacaaggtaaaag
ATGGAGCTAAGCG
gtaggtaaggctaaaccttgtcagccattgttaaatattgaattgtatcctaagcacaac
tcagtggaaagcagttaaagttctttaattgggggaggcaatgaaggggtaataaaattg
gttatagaaatactgctctggctctagtgttgagaatgaattggagtagccagagtagat

 5.02 Intr + 113343 113477  135  1  0   25   80   132 0.112   5.72
tgtcgaggtcctcttaagtccagacttttgatataatctgcagtttgcgccatttggatt
cctgaagcatctttacaagccacctacattccttatggagctgtggcacaacagcaagcc
cacgatgtctcaccggattaataaaaatataggcgctcacgcttttgtttaccgatatag
TATCTCCTCCTCCCCTCACTCCATCAACCCCCACGCGACACAACTTTCCGGAAGTAAGCA
AAATCCGTTATCAAGGTGAAACTCCGGGGACCAGGCTCCACAGCTGCCATAAACTGGATG
GCACGTTAGAAGCCG
gtgggtgtaggtgaggcacgctggcgcccgcgggcccttctccagccgctacccagtggg
aatccgcggggctgaagccccgaaaccaggctgagcgtcccagagcgcaacctccctttc
ccccagcagcgccggcgccgcagaagccgcgtgtccccaggcgcactcccccaaggtgaa

 5.03 Intr + 113989 114110  122  2  2   65   64    57 0.021   0.29
cctacagcaggtgacccatggccaatcgccaggggtctctttgccaggagccgccagggc
cagccaatcggggcgacccctccgccggggaggggacgggaaaggggtggggggtgaagg
gggtgaagggggtgtcccgggggacgggctgaacctcagtcaggaccgcctgcaccgcag
TCCGGGGATCGGGTCGAGGGGAGAAGAAAAAGGGGTGCTCGGGAGCAGCCCCCGGCTACC
TCCCCTGGAGGCACAGAGGGCGGGGGCCTTGGCGAATGGCTTTCTTGCTGGCCACTTGCG
GA
gtgagtagaccccgagggtctgggagaggggccggcccctacccctgagtccccggggtc
ccggccgccaggccggagcgcgaatgtcgtgctcaccctgcctccttcccgccgccccct
ggggtgagtaggacgacgtggctgcccgggcccctcttccttgggagttctcagttcctc

 5.04 Intr + 129645 129740   96  2  0   84   86    81 0.928   6.79
ggaagattgatgtaccactgtttaaatagacctaactgttaaatagacctattatttgtg
tcaaaatagaactgtattttaaaaattgaaatgtcttcatgtatgaagggaaaagtattt
tttgtactattaaactttgcttgggttctggtagatttattgcaaattctctttctctag
GGTTTGGATTCAGGATTTGTTCCTAGTGTCCAAGATTTTGATAAGAAACTTACAGAAGCT
GATGCTTACCTACAAATCTTGATTGAACAATTAAAG
gtatggcattagtttgtatattaaatttatataaatagaaaatgttactgagcttgattt
ttgagtaaaaacagttacttgatgttaatttacagccctcatgtggttcttcagcagttt
ttaaagcagacttaaaagatctagctgacttattcaaaggtctttatctctaattatatt

 5.05 Intr + 130819 130866   48  0  0   59   88    86 0.894   3.66
caatagaatttgactttgattgagtgctcgaaaaaaaatacatgttgtcttgaaaataac
atataaatcatccctggacaaaatgtgtttaagaacaaatgtttgtttttctgtgtttag
tgaatgtacatcgtatagtaaagtggcttgatactataaccattttttaaaatcttgtag
CTTTTTGATGACAAGCTTCAAAACTGCAAAGAAGATGAACAGAGAAAG
gtaacttccataaccgtgcttttgacgttaaaaattttaaattcagccttttggagaaca
ctaagtatcttagtgtgtttttacttactataataatattattgacctagtgtaatatta
ctgccatatggacctcaagggtacttttctgataaatttctgttatggtttcataattaa

 5.06 Intr + 140429 140467   39  1  0   64   92    61 0.685   1.60
cagagttagaattgtgtttggctaagaatgtacacatggaattaaaatcttagtggaggc
agataaatcatgttctaacattattacttacctagtaaataagctttcttgtaggagaaa
tacacaaggagttacttacatgtaagaatgaagttaatatttttaacatttttccttaag
GACCAGAGTAATGCGGAGAAGCACGCAGATGGAATGATA
gtaagtttaatgtaatctttttgtttccctttacttctgcagagcattataaccagtcat
atcaggagaagcctgaattactactcatttttcaatgccaactactcactgctttttgtt
gttgactcttgcagtttcctttaagctcccttctttcagcaatcatttgcaggggaaatg

 5.07 Intr + 144799 144889   91  0  1   69   91    52 0.956   2.25
tgctttaagcaactcttacacttctgtatagaaaaggtgtttcattccctcttttcattt
tgatcaacatatctatatagctaccctcaggattttgaagtcataaatgtgggcatttgg
gagggtagcatgagaagagcatttaattaaaaatagctatattgtgtttctttattttag
AGTACTATTAATCCCGTAGATGCAATATATCAACCTAGTCCTTTGGAACCTGTGATCAGC
ACAATGCCTTCCCAGACTGTGTTACCTCCAG
gtaatttgggaaaatgtttcttagattcattgatgagaaaaaaataatttgtgtggctgt
catagcagtcttagctattactgtttatttttgattttccttgtttttaataaaagcact
caaaaaataatacagccaaaagtgaactgaaaaaagatgataatgttttgatattggggc

 5.08 Intr + 145976 146080  105  0  0   63   92    50 0.769   2.17
atcatcattgagtttaagaggctaggaagtcaaaaggaaggagtagcatggaactagact
taatgaaataaagtttcaaaaattactggcctttaggattttgaatcccagacaattaca
gtcaatagaatgtgtgtttggctgtttctgtaccttattttatacgttcaaatctcctag
AACCTGTTCAGTTGTGTAAGTCAGAGCAGCGTCCATCTTCCCTACCAGTTGGACCTGTGT
TGGCTACCTTGGGACATCATCAGACTCCTACACCAAATAGTACAG
gtacagatttgcataatttctttatgtctcataactctattaacatttgaggtttgtttg
tgacctctgatgaggagggggaaagttgaagaaatgtgttgtatattttctgttggagat
atgttagttttaacattatagttccatacatgaagtggttagctttgtgtttgaaagaga

 5.09 Intr + 149931 150090  160  1  1   66   70    68 0.377   0.92
atcatgatttgccattttctgtgtggagtttaaatgttgattttctttataaatactgta
gcgacttttacaaacttaaccaaactcttttttgattttagaaaagtctgctttgactcc
atctccctagtttcttctctttcaccaatatttttctctaaaacccttttaacttcctag
GCAGTGGCCATTCACCACCGAGTAGCAGTCTCACTTCTCCAAGCCACGTGAACTTGTCTC
CAAATACAGTCCCAGAGTTCTCTTACTCCAGCAGTGAAGATGAATTTTATGATGCTGATG
AATTCCATCAAAGTGGCTCATCCCCAAAGCGCTTAATAGA
gtgagtagatgaacagaatatgtatttaaatgattctcctgatttttaaaaatctaattt
gattttgagactagtgttaatgacagacttgcctcatcagttattatttgggaaaattaa
aagggcaacctttttaatagaagtttttttattgatgtataatagttgtatggacaactt

 5.10 Intr + 156179 156291  113  2  2   30  119    52 0.453   1.60
tatcaacatggctttgttgagcacatcctgtgcataaaggataagacaagagaccttgtc
atcaagagaattctaaagcatatatatgcatgcatgtaaccagctaactgtacgagtcta
gcttactatgattctaaattgctttctttagcttaaataaggtaattaatgtttttatag
TTCTTCTGGATCTGCCTCAGTCCTGACACACAGCAGCTCGGGAAATAGTCTAAAACGCCC
AGATACCACAGAATCACTTAATTCTTCCTTGTCCAATGGAACAAGTGATGCTG
gtaagtgacctttgataatttaacttttttttctttaaaaatatttgtggccagatgtgg
tggctcatgccgtaatcccagcactttgggagaccgaggtgggcagatcacttgaggtcc
ggagttcaagaccagcctgaccaacatggtgaaaccccatctctactaaaaaaatacaaa

 5.11 Intr + 156714 156832  119  1  2   41  116   117 0.797   9.06
gaattgcttgaacctggaagatggaggtttacagtgagccaagatcgtgccattgcactc
cagcctgggcgaaagaatgagactccatctcaaacaaacaaacaaacaaaattgtaattc
tagtatcaggacagattggcccaatttagcaccattctaataagatctgctttattttag
ACCTGTTTGATTCACATGATGACAGAGATGATGATGCGGAGGCAGGGTCTGTGGAGGAGC
ACAAGAGCGTTATCATGCATCTCTTGTCGCAGGTTAGACTTGGAATGGATCTTACTAAG
gtaagaccaaatttgctgtaagtctgtgtgggtatgtatggattctcagtgattgcgtgg
tgagtgtgcctgcaaatgtagtaaaatgacataatttctttttatacctgtgtcttcttg
tgatttaatatagatgtagataagtaaacaaaattttataaatgatgaaataagtcaagc

 5.12 Intr + 158764 158839   76  0  1   96   14    11 0.487  -7.33
atttgtgtcttttataagaatgttttctcacttcagatactttccaaaaagagtttgttt
tccaaatactttgtagtttttaaaaatactacacagtcacatcccatttaacctcactca
gtctttaaaataaaagaaccctaacatataagcagggcatgtaattatcttccttttcag
GTACTTAGAGAAATTGAGTTAATTTTTCAGGGCCTCCTCACAGCTAAGAAGAGGCTAAAC
AAGCTCTTGAACCCAG
gttgaagacagctaaacccagctctcttcatcactgttacagcagtttgacttaatagca
tgtatcagtatagcactacaaacattgaagaaaatctgttaaataagagttctcagaaaa
atcctaagtagaagaaaaaaatatttattttttttaaattacgtgtgaaattaaactttt

 5.13 Intr + 160886 161027  142  0  1   88   53   104 0.658   5.39
tgacatttgaacattcaaaagtctttctctgtttttgatctgctaggcaggttaatggtc
atttctgaatctgacaggttgagaattagtttttggagcatgcctgggcaatatgtggtg
gatgttaccatgatttgaatgaggtggtgttttgttttgttttcttttttttttttttag
TCTGTTTATCTGAAGAGAAATTTGATCTTCAAGGGTCAAATGTGTATGTTTTTCAGGTAG
TTCTTCCAACGTTTATTCTTGAAAGAAGATCTCTTTTAGAAATGTATGCAGACTTTTTTG
CACATCCGGACCTGTTTGTGAG
gtatttgactgaacatggtagtttccaacgtttacagatgttactcagcagctttctgcc
ttttattttgcaggatagatggattccttgtcacctttcaaacatttctgggtattctgt
ggtattgaataatgtgtttacactggttgcctgtttgcttaaagttatatggtggcgatg

 5.14 Intr + 165273 165444  172  0  1  106   79   133 0.990  13.22
agaccaatgcatttaattatatatattatactcaattttaaaatgaaactgtaagctaac
tcctggtcctaggtcctcagtcctctcagcctgacttaggtggaccatgctgggggttgt
tgcatcatcttgtcttgtaccagaaagcaggacattaaattttgtctttctcccttgcag
CATTAGTGACCAGAAGGATCCCAAGGATCGAATGGTTCAGGTTGTGAAATGGTACCTCTC
AGCCTTTCATGCGGGAAGGAAAGGATCAGTTGCCAAAAAGCCATACAATCCCATTTTGGG
CGAGATTTTTCAGTGTCATTGGACATTACCAAATGATACTGAAGAGAACACA
gtgagttctgcattgacatttttaaattatcttaattgtatactgattcaagattttatt
taggggcaaataataatgatgaaagcaatgatcaaaagatggtcaccacccatagaagaa
attgttgttagagcagcatagtttgaatgtagtgagaaggaggaaaaagagtaggatgag

 5.15 Intr + 170635 170726   92  0  2   97  115    67 0.997   8.17
ctgtactactgcccactcagtgttcttaaacagaggaaagatgttatgaaattaacagga
ggagccagttaactgcattttggacctagagaatttgaagtgtcaaaagcactacaatgc
atctaacattaggttaggggtttatgggtctagttcccatccacctctattgttttctag
GAAAATACAGTCTTTGTAGATACCAAGAAGTTGCCTATAATCAAGAAGAAAGTGAGGAAG
TTGGAAGATCAGAACGAGTATGAATCCCGCAG
gtaagccgacattgttaagtggaactattgctgcagtgcttaaactttgcctaggcgtag
gcacagggctgggtttgagagacagtagggcagagcataatagtatagaccaagtttgaa
ttcctgggttcgtatgtcagaactaccacttactacctttgtgaccatggatggctcagt

 5.16 Intr + 171462 171597  136  0  1   77   98   163 0.988  15.85
cagtggagtcttctgagcccatatgtctgttccttactccagtgccctggtgccagcgta
aggagatttagtctgtgacctacagcacttaaagccatttgacttgtattatactatatt
caggatggctgcaggctttcattctcaacattggcagctcctcttacctctttgttttag
CCTTTGGAAGGATGTCACTTTCAACTTAAAAATCAGAGACATTGATGCAGCAACTGAAGC
AAAGCACAGGCTTGAAGAAAGACAAAGAGCAGAAGCCCGAGAAAGGAAGGAGAAGGAAAT
TCAGTGGGAGACAAGG
gtaagcttgcctgccccaccctcctaagtgctgttcctcctaatttatttcagtgaatgt
tgaagaagtgatgtgccaaacactgtttataaacaagatgatcgctggtccctacttgaa
actcatttcagtctaatggcggggtggggagcagatatgaaatagtaagtatattacaga

 5.17 Term + 171824 171898   75  1  0  120   39   110 0.999   6.16
atttcagtgaatgttgaagaagtgatgtgccaaacactgtttataaacaagatgatcgct
ggtccctacttgaaactcatttcagtctaatggcggggtggggagcagatatgaaatagt
aagtatattacagaagtacaaagcaaatatgtaactaaattcttcctctttgtcttacag
TTATTTCATGAAGATGGAGAATGCTGGGTTTATGATGAACCATTACTGAAACGTCTTGGT
GCTGCCAAGCATTAG
gttggaagatgcaaagtttatacctgatgatcagggcagtaggcataattcagcaacaaa
caatcttcctttgggagaaacctgttcattccaatcttctaattacagtggttcctatct
cagggatactggactttctgacgcagatgaacaattaaggggaaaagcttcccttttccc

 6.02 PlyA - 172979 172974    6                               1.05
 6.01 Term - 173542 173345  198  1  0  128   36   139 0.995   9.12

Predicted peptide sequence(s):


>OSBPL9_1|GENSCAN_predicted_peptide_1|106_aa
MASIMEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTKAQDQWPLYLTASRADRRELFPL
PRLKNFLGDDSVLPCGVVGPVIGQLPLSEKAVSGESSHTSFPIAPH

>OSBPL9_1|GENSCAN_predicted_peptide_2|199_aa
MTSAIFTTAIALEYSMHQRHWKQARHRKEETETLVLLKEKELKERSWQDTLVPCTGPNRH
KILQEEYYLHLKEEETKAQEAYDSFPFPLNKGMGKNGNQTQGDYLVDLIRCHHMRSFKSR
AFSAADSRMGSQKDSEHQKDSMHIADMKMEGSRPRDQEYVQPLEAESRTQLTANNNKKQK
TNRASVLQSQGIEFCKCPE

>OSBPL9_1|GENSCAN_predicted_peptide_3|90_aa
MVIGSESGLEMEICDRQHTAEGTLGTRVKRSEIGDKEPSVELTAEALVRDGEGLNQGSNG
GCFYLHRVHPDCQWMDYEWNMTIRSIKIDA

>OSBPL9_1|GENSCAN_predicted_peptide_4|630_aa
MDALHRDAEALGQASDPISLDLLQAVCQAFELPLYAQFPNVGCQAGSGKFQGIEEAQGDG
PSRPSGSQVACKISPELCMLMHASQKDLLVLIPKGKVEGLHGEAVDGAGQVPLQKDKCPA
PWGCGPCSPPHHAFVRCRHNLLTGMLHLQQCLDWLNSGRCPLGNSEGNASGHMTPPMASS
MAASRLRMGSLSSREIPSPSSRSEIPPKSNGGDTGADYVVGSINNFTTMEKAGTHLEGRA
KRVIHDNSGIVEGLITTLHAITATQKMWVDGTSGKLWHDDHEALKNIIPASTGAAKVVGK
VIPKLNGKITGMVFQVPTTYMSDLICHPENPAKYDDIKKVLKQAPEGPLKGILSYTEHPG
VSSDFNENHSSTFHDGATTALNDHFVRLNSWYDNENESGYTNRVVDLMVHMASKETNDKN
HMIISIDAEKAFDKIQQPFMLKTLNKLGVDGKYLKILISNFSKVSEYKINVQKSQAFLYT
NNRQTKSQIMCELPFTTASKRIKYLGIQLTRDMKDLFKENYKPLLNEIKEDTKKWKNIPC
SWVGRINIVKMATLPKNSIHSSGLRYNVTFSTYVAHAVKQPQAGPSGGIPEEGIVIIGDD
SSMPVIAPENLPAGQDVEAEDSDIKVPDPV

>OSBPL9_1|GENSCAN_predicted_peptide_5|577_aa
MELSVSPPPLTPSTPTRHNFPEVSKIRYQGETPGTRLHSCHKLDGTLEAVRGSGRGEKKK
GCSGAAPGYLPWRHRGRGPWRMAFLLATCGGLDSGFVPSVQDFDKKLTEADAYLQILIEQ
LKLFDDKLQNCKEDEQRKDQSNAEKHADGMISTINPVDAIYQPSPLEPVISTMPSQTVLP
PEPVQLCKSEQRPSSLPVGPVLATLGHHQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTV
PEFSYSSSEDEFYDADEFHQSGSSPKRLIDSSGSASVLTHSSSGNSLKRPDTTESLNSSL
SNGTSDADLFDSHDDRDDDAEAGSVEEHKSVIMHLLSQVRLGMDLTKVLREIELIFQGLL
TAKKRLNKLLNPVCLSEEKFDLQGSNVYVFQVVLPTFILERRSLLEMYADFFAHPDLFVS
ISDQKDPKDRMVQVVKWYLSAFHAGRKGSVAKKPYNPILGEIFQCHWTLPNDTEENTENT
VFVDTKKLPIIKKKVRKLEDQNEYESRSLWKDVTFNLKIRDIDAATEAKHRLEERQRAEA
RERKEKEIQWETRLFHEDGECWVYDEPLLKRLGAAKH

>OSBPL9_1|GENSCAN_predicted_peptide_6|65_aa
VVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFTTTLNLLPY
HKIVK