GENSCAN 1.0	Date run: 14-Jan-104	Time: 20:01:21

Sequence NR0B2_1 : 4881 bp : 51.87% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1230   1761  532  2  1   80  105   307 0.969  25.27
cccaccacttccccaccattcctgccaggggcaatgtctgtgtgtttttttcaatgaaca
tgacttctggagtcaaggttgttgggccattccccccgttccactcactgggaatataaa
tagcacccacagcgcagaacacagagccagagagctggaagtgagagcagatccctaacc
ATGAGCACCAGCCAACCAGGGGCCTGCCCATGCCAGGGAGCTGCAAGCCGCCCCGCCATT
CTCTACGCACTTCTGAGCTCCAGCCTCAAGGCTGTCCCCCGACCCCGTAGCCGCTGCCTA
TGTAGGCAGCACCGGCCCGTCCAGCTATGTGCACCTCATCGCACCTGCCGGGAGGCCTTG
GATGTTCTGGCCAAGACAGTGGCCTTCCTCAGGAACCTGCCATCCTTCTGGCAGCTGCCT
CCCCAGGACCAGCGGCGGCTGCTGCAGGGTTGCTGGGGCCCCCTCTTCCTGCTTGGGTTG
GCCCAAGATGCTGTGACCTTTGAGGTGGCTGAGGCCCCGGTGCCCAGCATACTCAAGAAG
ATTCTGCTGGAGGAGCCCAGCAGCAGTGGAGGCAGTGGCCAACTGCCAGACAGACCCCAG
CCCTCCCTGGCTGCGGTGCAGTGGCTTCAATGCTGTCTGGAGTCCTTCTGGAGCCTGGAG
CTTAGCCCCAAGGAATATGCCTGCCTGAAAGGGACCATCCTCTTCAACCCCG
gtgagctcccagacactcctgggtggggggcaaggctgaagcaggggccagccagggaag
gtagcttctaagggtttgatatctgttatctcattgggtcctcattttctttttattttt
ctgagacagagtctcactctgtcacccagtctggagtgcagtggtgcgatcttggctcac

 1.02 Intr +   3084   3321  238  1  1  139   60   133 0.789  12.80
atacattgaaaattgataaataaattacctcctctaaaggaggaggtagtagtgggacct
caaaggccgagcaaaggaggcagaggggtgtctctgatggcccagatcttgggccagtct
tgtcctttggtggctgggagtagggtgctcaccagccctcttctccctctctgcccacag
ATGTGCCAGGCCTCCAAGCCGCCTCCCACATTGGGCACCTGCAGCAGGAGGCTCACTGGG
TGCTGTGTGAAGTCCTGGAACCCTGGTGCCCAGCAGCCCAAGGCCGCCTGACCCGTGTCC
TCCTCACGGCCTCCACCCTCAAGTCCATTCCGACCAGCCTGCTTGGGGACCTCTTCTTTC
GCCCTATCATTGGAGATGTTGACATCGCTGGCCTTCTTGGGGACATGCTTTTGCTCAG
gtgacctgttccagcccaggcagagatcaggtgggcagaggctggcagtgctgattcagc
ctggccatccccagaggtgacccaatgctcctggagggggcaagcctgtatagacagcac
ttggctccttaggaacagctcttcactcagccacaccccacattggacttccttggtttg

 1.03 Term +   3940   4021   82  1  1   76   50    78 0.538   0.26
agcccaagggaaaaaatccacagggttgctggagctaattttccagggaacagtatcagt
tcacaatcccatcacctcattgtctttatcctcaggggaaggaggttgctctcccattcc
caaacccttcactaaccgctcccctggctcctacccacttcaggcgccctcttaccacag
TGAAAGCCCAATCACAGCCAATCAGGAAGCAGCCCACTCCCGAATTGAAACAGACAAGTT
CACTGCCATTTCTGTAGTTTGA
gatcattcacttcccccattcctgcagatgacaaaagagagtggtccattattttcccaa
agggaagggacaagggtacccagggctggcctggcaactgcttgaaggccaaggcagacc
aaggtttagctggaccaccaggatttgactacatcagttgtttaagtctgaaacccttcc

Predicted peptide sequence(s):


>NR0B2_1|GENSCAN_predicted_peptide_1|283_aa
MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCAPHRTCREAL
DVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKK
ILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSLELSPKEYACLKGTILFNPDVP
GLQAASHIGHLQQEAHWVLCEVLEPWCPAAQGRLTRVLLTASTLKSIPTSLLGDLFFRPI
IGDVDIAGLLGDMLLLSESPITANQEAAHSRIETDKFTAISVV