GENSCAN 1.0	Date run: 14-Jan-104	Time: 18:10:35

Sequence NPPB_1 : 3864 bp : 54.45% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1299   1430  132  2  0   84   94   131 0.927  11.43
aaccctgcatggcagggcaggcccgacactcagctccaggataaaaggccacggtgtccc
gaggagccaggaggagcaccccgcaggctgagggcaggtgggaagcaaacccggacgcat
cgcagcagcagcagcagcagcagaagcagcagcagcagcctccgcagtccctccagagac
ATGGATCCCCAGACAGCACCTTCCCGGGCGCTCCTGCTCCTGCTCTTCTTGCATCTGGCT
TTCCTGGGAGGTCGTTCCCACCCGCTGGGCAGCCCCGGTTCAGCCTCGGACTTGGAAACG
TCCGGGTTACAG
gtgagagcggagggcagctcagggggattggacagcagcaatgaaagggtcctcacctgc
tgtcccaagaggccctcatctttcctttggaattagtgataaaggaatcagaaaatggag
agactgggtgccctgaccctgtacccaaggcagtcggttcacttgggtgccatgaagggc

 1.02 Intr +   1663   1918  256  0  1   75  121   289 0.993  28.45
tcacctgctgtcccaagaggccctcatctttcctttggaattagtgataaaggaatcaga
aaatggagagactgggtgccctgaccctgtacccaaggcagtcggttcacttgggtgcca
tgaagggctggtgagcccaggggtgggtccctgaggcttggacgcccccattcattgcag
GAGCAGCGCAACCATTTGCAGGGCAAACTGTCGGAGCTGCAGGTGGAGCAGACATCCCTG
GAGCCCCTCCAGGAGAGCCCCCGTCCCACAGGTGTCTGGAAGTCCCGGGAGGTAGCCACC
GAGGGCATCCGTGGGCACCGCAAAATGGTCCTCTACACCCTGCGGGCACCACGAAGCCCC
AAGATGGTGCAAGGGTCTGGCTGCTTTGGGAGGAAGATGGACCGGATCAGCTCCTCCAGT
GGCCTGGGCTGCAAAG
gtaagcaccccctgccaccccggccgccttcccccattccagtgtgtgacactgttagag
tcactttggggtttgttgtctctgggaaccacactctttgagaaaaggtcacctggacat
cgcttcctcttgttaacagccttcagggccaaggggtgcctttgtggaattagtaaatgt

Predicted peptide sequence(s):


>NPPB_1|GENSCAN_predicted_peptide_1|130_aa
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVE
QTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRI
SSSSGLGCKX