GENSCAN 1.0	Date run: 14-Jan-104	Time: 19:08:55

Sequence MED8_1 : 6905 bp : 46.10% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1135   1314  180  1  0   75   99   111 0.781   9.88
gatggggaaaaggaatcagttggtggaaggacttggggtcaggcaaacaggttggaaggt
ctcagggttgatgctgtctataacccaaataccaaagatagaaaacaacctggctatcct
atgccaatgagatcctgtgttacctgactggtgttgcacaccatctccttggctttccag
CCCTCCTTTCTATGTGTCATACTCGTTTATCTGGGTGACCAACCTGTTCCTATTGGTGCA
GAGAGAGGAGAAGCAGCTTGAGGCATCATTAGATGCACTGCTGAGTCAAGTGGCTGATCT
GAAGAACTCTCTGGGGAGTTTCATTTGCAAGTTGGAGAACGAGTATGGCCGGCTGACCTG

gtaagagttaccagggcaagctaggaagggcttatgggtgggggggcctagcctcctgat
gaataggacatttctaatgatgtaaccatttatcagtttgcaaacatcttttgatttgga
aagagctgggtttcctaacatttagcaagtggattccatggcaaggaagtagagaaatgc

 1.02 Intr +   1977   2121  145  0  1   46   95   186 0.569  15.38
atgtccctctttcatagccctgtcatccctgttagtctgttcccacttaggctagtcata
gggctatgagacttttggaggtgaatccaagtgttcctagcctgaaggaactaggactat
tttactaagaaccacccagggaaggggtacaacattcttacaccttgttaccaccaccag
GCCATCTGTCCTGGACAGCTTTGCCTTGCTTTCTGGACAGCTGAACACTCTGAACAAGGT
CTTGAAGCATGAAAAAACACCGCTGTTCCGTAACCAGGTCATCATTCCTCTGGTGTTGTC
TCCAGACCGAGATGAAGATCTCATG
gtaagaggagaaaaagaatacaacttgggaaattaaggggttttttaggcttctttagta
tttagggaaattaagttattagctgagagcctagaaataattttggaggccttgcttttt
gttcttctgaaggcgggagagccactcccaaatagtgctgtaataacctgaggggtatgt

 1.03 Intr +   2626   2766  141  0  0   21   47   134 0.725   3.15
agaagacacaaaaaatgaaggatggagtaaaggagagtgtgtcctagcaaactagatatt
atgtctcaggttgtattttccttgaaaatgcactgtttgcctgtggatgggactttatgt
caggccagatagaatcttcttggagtacagagtaggatcaataaaatctgtgtgttacag
CGGCAGACTGAAGGACGGGTGCCTGTTTTCAGCCATGAGGTAGTCCCTGACCATCTGAGA
ACCAAGCCTGACCCTGAAGTGGAAGAACAGGAGAAGCAACTGACGACAGATGCTGCCCGC
ATTGGTGCAGATGCAGCCCAG
gttggactgagtcactgccttgctgccccatccccatcccatcatgagaagctaggcatt
accattcctgtctagtagggatacatagttggttgcgcctaagttgcttctggcagaacc
caaggaataaatttctccatatcgtttcctagttaccctaatctctgcacaaatttgtgt

 1.04 Intr +   2954   3071  118  1  1   77   61    73 0.714   3.54
tgagtcactgccttgctgccccatccccatcccatcatgagaagctaggcattaccattc
ctgtctagtagggatacatagttggttgcgcctaagttgcttctggcagaacccaaggaa
taaatttctccatatcgtttcctagttaccctaatctctgcacaaatttgtgtgttacag
AAGCAGATCCAGAGCTTGAATAAAATGTGTTCAAACCTTCTGGAGAAAATCAGCAAAGAG
GAGCGAGAATCAGAGAGTGGAGGTATGATGGGACTGGTGGCTAAACAGAGAAGGAGAG
gtatataagatcactggaatgggaatggttgttttggaagtagtgaagttaggacacaag
ggtgaactgctttggggtttgtatccattctgttagccttttgtatttaaggccagcact
gaagcagtggaggaaatgggcaaagtaagaagagagaattctgagataggcttgggggtc

 1.05 Intr +   3398   3646  249  0  0   75  110    75 0.633   5.81
aagaagagagaattctgagataggcttgggggtcctctggctctttttctgggctgtgag
ggagtctagatgttgctgaattcagaactccaaaccctggcactcatactggtcttccag
ctgccacgttcagtcctgcatcagaagcatacttcaggatccccattactttttcttcag
GTCTCCGGCCGAACAAGCAGACCTTTAACCCTACAGACACTAATGCCTTGGTGGCAGCTG
TTGCCTTTGGGAAAGGACTATCTAATTGGAGACCTTCAGGCAGCAGTGGTCCTGGCCAGG
CAGGCCAGCCAGGAGCTGGGACGATCCTTGCAGGAACCTCAGGATTACAGCAGGTGCAGA
TGGCAGGAGCTCCAAGCCAGCAGCAGCCAATGCTCAGTGGGGTACAAATGGCTCAGGCAG
GTCAACCAG
gtaaggtggcaggggttgaaatgaagctgactttgagcaggagtgggagggaataagcta
gattatctgggcctccagcatctctagacctagaggttttctctatttctccttttcact
gtgacccaggaaataattttcagaagtaaaaaaatctcatctgagactctgcaacaggca

 1.06 Term +   4518   4582   65  1  2  114   48    63 0.685   2.95
caccttcagggagacagctgggtgaagaatcatacttctgacctctgtcaaacagggtca
gatgccgcagaggttctgagatgataaaggaagtgacagagggaacctgaggtaccacat
ttctgatttgtcatgaaagtcttaccttgcttaagatgacttttttaatgttcctttcag
GGAAAATGCCAAGTGGAATAAAAACCAACATCAAGTCGGCTTCCATGCATCCCTACCAGC
GGTGA
gtgtggctggcaacctcgactccctggtgctctttgcagagttgggcagtgaaattacct
tttgctcaaggctcacctagatgggtacaataaaaagaacatgggctttcagcagcagac
aaatcccacttccaccactgactagctgtgtgaccttggacaagtgacctaatttttctg

Predicted peptide sequence(s):


>MED8_1|GENSCAN_predicted_peptide_1|299_aa
XPPFYVSYSFIWVTNLFLLVQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLT
WPSVLDSFALLSGQLNTLNKVLKHEKTPLFRNQVIIPLVLSPDRDEDLMRQTEGRVPVFS
HEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCSNLLEKISKEERES
ESGGMMGLVAKQRRRGLRPNKQTFNPTDTNALVAAVAFGKGLSNWRPSGSSGPGQAGQPG
AGTILAGTSGLQQVQMAGAPSQQQPMLSGVQMAQAGQPGKMPSGIKTNIKSASMHPYQR