GENSCAN 1.0	Date run: 14-Jan-104	Time: 18:57:39

Sequence LOR_1 : 3596 bp : 54.17% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Term +   1202   2163  962  0  2  118   36  1276 0.679 118.12
ttctgcaggggaatgaggaactcaacttttccaaaagcagcaatcataagaaaccccgct
gagggctctccgggcacctgaaggagccctgggaggatggcgatgttgcctatggatgca
gctgcctccgtaagtatcctcttgcagctggtccagcgatgctctcttctccccttccag
GCTCTCCTTCCTTCTCAGACAAGATGTCTTATCAGAAAAAGCAGCCCACCCCTCAGCCCC
CAGTGGACTGCGTGAAGACCTCTGGCGGCGGTGGCGGTGGCGGCGGCAGCGGCGGTGGTG
GCTGCGGCTTCTTCGGCGGCGGCGGCTCAGGGGGCGGTAGCAGCGGTTCTGGCTGCGGCT
ACTCCGGCGGCGGTGGCTACTCTGGCGGCGGCTGCGGCGGGGGCTCCTCCGGCGGCGGGG
GCGGGGGCGGCATTGGAGGCTGCGGAGGGGGCTCCGGTGGGAGCGTCAAGTACTCCGGAG
GCGGCGGCTCCTCCGGCGGGGGCTCTGGCTGTTTCTCCAGCGGTGGGGGCGGCTCCGGCT
GCTTCTCCTCCGGTGGCGGCGGCTCCTCCGGGGGCGGCTCCGGCTGCTTCTCCAGCGGTG
GGGGCGGCTCCTCCGGGGGCGGCTCCGGCTGCTTCTCCTCCGGCGGCGGCGGCTTCTCGG
GCCAGGCGGTCCAGTGCCAGAGCTACGGAGGCGTCTCTAGCGGCGGCTCCTCCGGGGGCG
GCTCCGGCTGCTTCTCCAGCGGCGGGGGCGGCGGCTCTGTCTGCGGCTACTCTGGCGGCG
GCTCTGGCTGCGGCGGAGGCTCCTCTGGCGGCAGCGGCTCCGGCTACGTCTCCTCGCAGC
AGGTCACTCAGACCTCGTGCGCGCCCCAGCCGAGTTACGGAGGGGGGTCGTCCGGCGGCG
GCGGCAGCGGCGGAAGCGGCTGCTTCTCCAGCGGCGGGGGCGGCGGGAGCTCCGGCTGCG
GCGGCGGCTCCTCCGGGATTGGCAGCGGCTGCATCATCAGTGGCGGGGGCTCCGTCTGCG
GAGGTGGTTCCTCTGGAGGCGGCGGCGGCGGCTCCTCCGTGGGTGGCTCCGGGAGTGGCA
AGGGCGTCCCGATCTGCCACCAGACCCAGCAGAAGCAGGCGCCTACCTGGCCGTCCAAAT
AG
atcccccagggtaccacggaggcgaaggagttggaggtgttttccaggggcaccgatggg
cttagagctctcatgatgctacccgaggtttgcaaatccttcatgtcttaacctacctgg
aagaagccattgagctctccggctgcatctagttctgctgtttagcctctttggtttctg

Predicted peptide sequence(s):


>LOR_1|GENSCAN_predicted_peptide_1|320_aa
XSPSFSDKMSYQKKQPTPQPPVDCVKTSGGGGGGGGSGGGGCGFFGGGGSGGGSSGSGCG
YSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSG
CFSSGGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGG
GSGCFSSGGGGGSVCGYSGGGSGCGGGSSGGSGSGYVSSQQVTQTSCAPQPSYGGGSSGG
GGSGGSGCFSSGGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSG
KGVPICHQTQQKQAPTWPSK