GENSCAN 1.0	Date run: 14-Jan-104	Time: 17:39:40

Sequence LAMB3_1 : 39912 bp : 49.97% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   3495   3649  155  1  2   59   80   105 0.701   6.59
aatcaactttcaaaatataacagtatcaatactgcaattattactgccagcagcgagtgg
aagcttgagtgagggaaaggatataatcttgctaatgtcagcttccctgaaagatactgg
ggtggccagtgaggtccctttttttctggactgctccatcacacatccctgtgatttcag
CCCTGCCTGGCCTCCTGCATGCCCAACAAGCCTGCTCCCGTGGGGCCTGCTATCCACCTG
TTGGGGACCTGCTTGTTGGGAGGACCCGGTTTCTCCGAGCTTCATCTACCTGTGGACTGA
CCAAGCCTGAGACCTACTGCACCCAGTATGGCGAG
gtaggccctacttcccaggactggaggaaggcgggatgggaggggtgtgtgagctgccat
ttgtccactgaatacttagaatgtacttggtgtaggccaagccctgtgtactacacggac
tggggagtgcagtaaaagtataaggccagatccttgcctctaaggaatttacctgttggt

 1.02 Intr +  14965  15079  115  0  1  110   89    66 0.986   8.92
ccaattaaaaggtgatcaatagctgtgttttaagagattaacccttcaaattgtattaat
aaaattagtgattcctaagggcaggatttccacagaggagatatgctgggatctcaggac
gcaagggggaattctatcaggaccccacctctgagtgtctgctatctccctctcccacag
TGGCAGATGAAATGCTGCAAGTGTGACTCCAGGCAGCCTCACAACTACTACAGTCACCGA
GTAGAGAATGTGGCTTCATCCTCCGGCCCCATGCGCTGGTGGCAGTCACAGAATG
gtgagcatttgccatctacgggaactcaaactgtacagcctccacaggataagacggatg
gaaggtgccctataaccctttgggtttcccaggcatttcttatggtggtgtgacatgggt
gattgataagaagaatctttctgcctcatatttggggtctgttggatgttatggtagaag

 1.03 Intr +  15632  15705   74  0  2  116   69    51 0.988   5.13
gatcttgaatagataatataagcagaaacataccactccccactcctctccaagagggag
tttggaaaatcaaggttagagagtttctgagttcctagagctagtctaatccagggcttc
cttcagggctggggaagtggacagtctctggatgacagtttctattttttgtccttccag
ATGTGAACCCTGTCTCTCTGCAGCTGGACCTGGACAGGAGATTCCAGCTTCAAGAAGTCA
TGATGGAGTTCCAG
gtgtgcctcctgggggtggcagtggataggagaggggctcctgggccatgtgggcgtgga
gccatggaggagcacagtgtccttgtctctctgggttggggcaacactcaccatgagcct
atatcatggtgacagaagaggactcgctcctgggctaaaagtggcacctcctggctccct

 1.04 Intr +  18975  19166  192  2  0  127  100   194 0.989  24.19
gggagaaacttctgtggcctgtggtatgccaggaggtttggacccggatgctccgagccc
acttgctcccactgggccccctttctcccgagttcactggaggagcctgtctctctgctt
gtgtctccacggggcacagccccagtgcctcccctctgcacactgcccctgtctccacag
GGGCCCATGCCCGCCGGCATGCTGATTGAGCGCTCCTCAGACTTCGGTAAGACCTGGCGA
GTGTACCAGTACCTGGCTGCCGACTGCACCTCCACCTTCCCTCGGGTCCGCCAGGGTCGG
CCTCAGAGCTGGCAGGATGTTCGGTGCCAGTCCCTGCCTCAGAGGCCTAATGCACGCCTA
AATGGGGGGAAG
gtaggtagagggaatcctgaaaagtaggcctggggagaaatccctgatgtcccactgttc
acacagccacacggactcctgagaagggacggaaacaccctcgccagctccccttgctga
ctttcctgaattcccaccagtaatgacccctgtggccaccctcaaaacatttgctgctta

 1.05 Intr +  20950  21030   81  0  0   76   92    21 0.350   1.13
gcctctaacttcctttctttattttccattctccaactcttccctccttgctgtttggcc
ctctcagaggtgggggagatcacaaacttgagagtcaatttcaccaggctggcccctgtg
ccccaaaggggctaccaccctcccagcgcctactatgctgtgtcccagctccgtctgcag
GGGAGCTGCTTCTGTCACGGCCATGCTGATCGCTGCGCACCCAAGCCTGGGGCCTCTGCA
GGCCCCTCCACCGCTGTGCAG
gtaacagcctagggtgggaaggggagaggaagggggcaggaccagggcagactacagaca
ttcttggggctcctgtaaagcaggaagggcactaaatctaagacttgggtatttaatact
tcagcagcaacaacaaaaaatcgaagtggttttcgttccaaaaatcagaatcatttagta

 1.06 Intr +  22878  22998  121  2  1  111   19   152 0.917  10.67
tagcagacagtttcacaggagctgggtgaagtctgcggcattcagaggaagcttcctgga
agggttgggatctaagccagatcctgagtggtgcgcagagggtcagagggcagtgggcag
gtccatccctggtgcccttctttgttgattactcctgatggctgacggtccccctcccag
GTCCACGATGTCTGTGTCTGCCAGCACAACACTGCCGGCCCAAATTGTGAGCGCTGTGCA
CCCTTCTACAACAACCGGCCCTGGAGACCGGCGGAGGGCCAGGACGCCCATGAATGCCAA
A
gtaggagctttggatcacccctcccctgtagggtctgggtcgagtgctggcccctctagg
ccttgatgatctcacctgggatgcagggggatccagtctttcttatgtaaatctaaactg
aattgcaccattacaattcaagctctcctggctctgtgaggatggagagagtatttgggt

 1.07 Intr +  23688  23876  189  1  0   76   65   205 0.992  16.56
tcttattggtcatgtaaccttaaataagttatacaaacctcccttgccctcagtttcccc
acttccctgccttgatcatcttgcagagttgttacagatgccagtgagcttttgtggagc
atgctctgtagatagcaaaggtgtgggtcagatgtcagccctgggactctctttttccag
GGTGCGACTGCAATGGGCACTCAGAGACATGTCACTTTGACCCCGCTGTGTTTGCCGCCA
GCCAGGGGGCATATGGAGGTGTGTGTGACAATTGCCGGGACCACACCGAAGGCAAGAACT
GTGAGCGGTGTCAGCTGCACTATTTCCGGAACCGGCGCCCGGGAGCTTCCATTCAGGAGA
CCTGCATCT
gtgagtagaggctccggagtcccagagtgtcatttgtctgttactccccatctcctctgg
gtacaatagagtacatgttcctgggcacaccaaggccctcagggagcatgaaaacttggc
tgtgagtcaggatttgtgggagattattttaatttagctattactgagcaagtcacttaa

 1.08 Intr +  25423  25578  156  2  0   58   84   166 0.996  13.18
ttatttttattttatagacaaggaaattgaggcacagagggattaagtaacttgactaag
gctgtgaatttgaaatccagtggtggaacaaggatttgaaccaggcagcctggctcctgg
aatctgctctgaactctacttttctttgttcctactgcggtggctgctgttgtctctcag
CCTGCGAGTGTGATCCGGATGGGGCAGTGCCAGGGGCTCCCTGTGACCCAGTGACCGGGC
AGTGTGTGTGCAAGGAGCATGTGCAGGGAGAGCGCTGTGACCTATGCAAGCCGGGCTTCA
CTGGACTCACCTACGCCAACCCGCAGGGCTGCCACC
gtgagtagggggcttggcccagcatgacgtggggtgggctgcatggggccaccagaccca
cggcttgccctgctcactgtgctctcttcagaggaaatcccactgcagggtagacagagg
gggtatgcccgggcctttgccaggagtccggacttcttgccctcttacccagcgccagat

 1.09 Intr +  26034  26230  197  1  2   69   96   203 0.957  18.33
gctgccaggtggctggaactggtgggacagcgcaggggtcctgtgagtcagccatgtcat
ctgcagggaagggccctgcccagttcttttcccaggcagcgcccctccctggatgtgtgt
cctctgggggtgagtttttcatggagcgtctgcctgagctcagcagctctcctcctgcag
GCTGTGACTGCAACATCCTGGGGTCCCGGAGGGACATGCCGTGTGACGAGGAGAGTGGGC
GCTGCCTTTGTCTGCCCAACGTGGTGGGTCCCAAATGTGACCAGTGTGCTCCCTACCACT
GGAAGCTGGCCAGTGGCCAGGGCTGTGAACCGTGTGCCTGCGACCCGCACAACTCCCTCA
GCCCACAGTGCAACCAG
gtacgaagtgagggtggtccgggggccccctcagtgggaggggggtcctgagcaccagcc
tctctgctgcccctccatgctgcccttctaggcctctcccctgtcagactgggcgtcttc
tgtccccgttctcatttggggaagtcaccagatgtccctccctctgtggctcttggccgt

 1.10 Intr +  26635  26746  112  0  1   69   42   152 0.994   8.65
gccttgacttcaaggctcatctctgagtgggagcccttgttttgtgggcacagcagctct
ggaggtggccatgagccctggattctacctgtggaccaggaatctaggacacagtccctg
acaccagggtaaggcagaggctgtgaggcagggtccactgacggtgctctccccacgcag
TTCACAGGGCAGTGCCCCTGTCGGGAAGGCTTTGGTGGCCTGATGTGCAGCGCTGCAGCC
ATCCGCCAGTGTCCAGACCGGACCTATGGAGACGTGGCCACAGGATGCCGAG
gtgcatgctcaaagcctgggggacgctgaggctctgggggccgagcacgcgggtgggcac
atggtgggggcgtgtaggtctgcagcagggcaggatgtcctgtactgatgcatgtggtgt
gggcctgggcagccctgtgagtgcacacactccggcctgttggcatggcctccaagcccc

 1.11 Intr +  27587  27965  379  0  1  110   91   454 0.989  41.92
gctaagtaagcgtttgctttcactgcagctgttaccatggcttttattctggctgcgact
tctgttattctaagtcatgtagaaagagcctcaggtcagacctcctcttcagggctctcc
ctgacagctgcttctgtctccctgacccctgtctctgactgtcatttttcttggccctag
CCTGTGACTGTGATTTCCGGGGAACAGAGGGCCCGGGCTGCGACAAGGCATCAGGCCGCT
GCCTCTGCCGCCCTGGCTTGACCGGGCCCCGCTGTGACCAGTGCCAGCGAGGCTACTGTA
ATCGCTACCCGGTGTGCGTGGCCTGCCACCCTTGCTTCCAGACCTATGATGCGGACCTCC
GGGAGCAGGCCCTGCGCTTTGGTAGACTCCGCAATGCCACCGCCAGCCTGTGGTCAGGGC
CTGGGCTGGAGGACCGTGGCCTGGCCTCCCGGATCCTAGATGCAAAGAGTAAGATTGAGC
AGATCCGAGCAGTTCTCAGCAGCCCCGCAGTCACAGAGCAGGAGGTGGCTCAGGTGGCCA
GTGCCATCCTCTCCCTCAG
gtaattccctttccctgccaagcatttgcaagaattatgctccaggggttccagtaccgg
gcatgctggtccttccttacatttgtacagtgcattacagtttaaaggcattttcacagt
gctctctctttcaaccattacaacagtcctgtgaggctggtgtggttttgcagatgagaa

 1.12 Intr +  29613  29773  161  0  2   94   94   110 0.870  11.83
gtgctggtcgccaagcctctgtccagcggaacccccttagcctgtggattctctgttctg
ttgcctttgcccaaggtctctgtttgttctgactcagtagcagttgctctgaggggatag
ctgctttggggaggcaaaactccctcctatattttagtgtaagctcctctcccttctcag
GCGAACTCTCCAGGGCCTGCAGCTGGATCTGCCCCTGGAGGAGGAGACGTTGTCCCTTCC
GAGAGACCTGGAGAGTCTTGACAGAAGCTTCAATGGTCTCCTTACTATGTATCAGAGGAA
GAGGGAGCAGTTTGAAAAAATAAGCAGTGCTGATCCTTCAG
gtgaggagaggggcacccggataaccccgggcatgggcactgccgtggtgggcatgccac
cccctctccctcctgctcctcctccatctccattcctcatgcttctcgccacaggagcct
tccggatgctgagcacagcctacgagcagtcagcccaggctgctcagcaggtctccgaca

 1.13 Intr +  29888  30108  221  0  2  100   57   250 0.863  21.12
gtctccttactatgtatcagaggaagagggagcagtttgaaaaaataagcagtgctgatc
cttcaggtgaggagaggggcacccggataaccccgggcatgggcactgccgtggtgggca
tgccaccccctctccctcctgctcctcctccatctccattcctcatgcttctcgccacag
GAGCCTTCCGGATGCTGAGCACAGCCTACGAGCAGTCAGCCCAGGCTGCTCAGCAGGTCT
CCGACAGCTCGCGCCTTTTGGACCAGCTCAGGGACAGCCGGAGAGAGGCAGAGAGGCTGG
TGCGGCAGGCGGGAGGAGGAGGAGGCACCGGCAGCCCCAAGCTTGTGGCCCTGAGGCTGG
AGATGTCTTCGTTGCCTGACCTGACACCCACCTTCAACAAG
gtgacttggggcatggagtcccacttcctggagcccacaccccagcttgtcacacaccaa
ctgctgccacctgcttcctattagggcagatctgcccctgtgagaaccccactcccccag
ccatcccgacccttgtactgctcactgtgagctcagtggttgccaaggaaaccagtttct

 1.14 Intr +  30198  30367  170  2  2   39   64    65 0.765  -2.06
gggaggaggaggaggcaccggcagccccaagcttgtggccctgaggctggagatgtcttc
gttgcctgacctgacacccaccttcaacaaggtgacttggggcatggagtcccacttcct
ggagcccacaccccagcttgtcacacaccaactgctgccacctgcttcctattagggcag
ATCTGCCCCTGTGAGAACCCCACTCCCCCAGCCATCCCGACCCTTGTACTGCTCACTGTG
AGCTCAGTGGTTGCCAAGGAAACCAGTTTCTGGTCCTTAGCTCTCATGGAGATGTCTGGC
TGTTTCTGGTGCTTGGTTGTCATGGAGATGTCTGGCTGTTGGTTTCCCAG
gtgtggggtgggattggttattgaggggctttgggtagcctctttaacaccgccatctgt
ccacagctctgtggcaactccaggcagatggcttgcaccccaatatcatgccctggtgag
ctatgtccccaagacaatggcacagcctgtggctcccgctgcaggggtgtccttcccagg

 1.15 Intr +  30547  30631   85  1  1   70  115    67 0.802   7.42
ggtgtggggtgggattggttattgaggggctttgggtagcctctttaacaccgccatctg
tccacagctctgtggcaactccaggcagatggcttgcaccccaatatcatgccctggtga
gctatgtccccaagacaatggcacagcctgtggctcccgctgcaggggtgtccttcccag
GGCCGGTGGGGCCTTCTTGATGGCGGGGCAGGTGGCTGAGCAGCTGCGGGGCTTCAATGC
CCAGCTCCAGCGGACCAGGCAGATG
gtaagtgcagccgaggcggggtgggcacaggtaggaggaggcagacaggatagatccccc
gggcaagtcagagttcccattttacactaaagtccagagattttaggtgacctgcttaag
gtgccacagcaagtgcaagatagttttttttctcttttactgaacatccacatgtaagct

 1.16 Intr +  30918  31077  160  2  1   56   99   152 0.503  12.66
gtgacctgcttaaggtgccacagcaagtgcaagatagttttttttctcttttactgaaca
tccacatgtaagctgggttggttacaaatgcttcctaggtaggtcttggcatagaggatg
atccgcagaatcgtggggctgctgagaggttcccttggggccttaccccttctgacctag
AGTGTATGTCAACAGATTAGGGCAGCCGAGGAATCTGCCTCACAGATTCAATCCAGTGCC
CAGCGCTTGGAGACCCAGGTGAGCGCCAGCCGCTCCCAGATGGAGGAAGATGTCAGACGC
ACACGGCTCCTAATCCAGCAGGTCCGGGACTTCCTAACAG
gtgagcccagtctccaccccaccttggctgctgttccagtcctgcctgtcccgcattccc
atgttcagtgcatcagccagccctccctccctagtcccaggcctgcaacatccaggcctc
cacttctccttggcaccatggccatgaccttctcgttctcccgtctgccctccccaccca

 1.17 Intr +  34954  35161  208  2  1   78   80   232 0.997  19.54
cccagaaatccctggagaacaggcgcctgagtctggttgaaagggggcagcagctccttg
ggacaccacggtagaggggccactgtgggtgccttccacaagtgctgctcagctaggaga
ggcctcgtatctctggggaggttagtgggctcctacagtcaaatgcgtgttgtcttccag
ACCCCGACACTGATGCAGCCACTATCCAGGAGGTCAGCGAGGCCGTGCTGGCCCTGTGGC
TGCCCACAGACTCAGCTACTGTTCTGCAGAAGATGAATGAGATCCAGGCCATTGCAGCCA
GGCTCCCCAACGTGGACTTGGTGCTGTCCCAGACCAAGCAGGACATTGCGCGTGCCCGCC
GGTTGCAGGCTGAGGCTGAGGAAGCCAG
gtatggccttgggccctgaacttctctctgcccaggattaagctggcgttttgctcctca
accccgttgctgggagaggggtacagagggctgggagacaggagggggtgcttaccatgg
tggagagtggtacacagagtccagagtgcaggttaaacttaatttgcatgactgtgtctt

 1.18 Intr +  35565  35706  142  0  1   98   78    96 0.997   9.96
acattcatcacgtctgcttggtggggtcctgggacatcaaagctactgagttaatacttt
ccttgctctttgccttggctgggaagggtgttcttttggactggtgtgtgagtcgaacca
cacattgattcactgttcactcattctctctctcctctccctgctgcttctctcacccag
GAGCCGAGCCCATGCAGTGGAGGGCCAGGTGGAAGATGTGGTTGGGAACCTGCGGCAGGG
GACAGTGGCACTGCAGGAAGCTCAGGACACCATGCAAGGCACCAGCCGCTCCCTTCGGCT
TATCCAGGACAGGGTTGCTGAG
gtgaggcattatggcttcctccgcccatatttgggcataaacaggaaaatttgggcacca
ggcatagaaaatgccagaaagtgactagataaaacctgaggtggagttctagaggagagt
gacaagctttgggcaggctatgggccttggattttctggtcttgtggctgggatgcagaa

 1.19 Intr +  36027  36203  177  2  0   37   77   219 0.991  15.82
tgggccttggattttctggtcttgtggctgggatgcagaaggaggggtgagaggtgggca
attgtgtttgttctggttggagagggtttttgctgcctgatgagttggagaaaaaatggg
gatgaaccccccgacctatgagacccaccacaaaggccagatctccctctttccacaaag
GTTCAGCAGGTACTGCGGCCAGCAGAAAAGCTGGTGACAAGCATGACCAAGCAGCTGGGT
GACTTCTGGACACGGATGGAGGAGCTCCGCCACCAAGCCCGGCAGCAGGGGGCAGAGGCA
GTCCAGGCCCAGCAGCTTGCGGAAGGTGCCAGCGAGCAGGCATTGAGTGCCCAAGAG
gtacagagaaggcggagttagctcaatgatgtacggccagtgagggggtcctgagcagag
gaggactttgcacactttataagaccacaaactcaaaagtgcttagaataacagaaccag
aagaggcttgagagtcaacccaaacctggccaggcatctgatttctccctccactgcttt

 1.20 Intr +  36989  37142  154  1  1  107  100   117 0.999  14.45
agaagtttaagtcatagtctgtggctcaggggtttcaataggcaaaaccaatgctattgg
gggctaataggaggcaccttcccactgtgtattgatttgggtgatatcaagtgctttggc
cacaggtctttaggaccttgcatgatgacaatgacactgagactattctacctttttcag
GGATTTGAGAGAATAAAACAAAAGTATGCTGAGTTGAAGGACCGGTTGGGTCAGAGTTCC
ATGCTGGGTGAGCAGGGTGCCCGGATCCAGAGTGTGAAGACAGAGGCAGAGGAGCTGTTT
GGGGAGACCATGGAGATGATGGACAGGATGAAAG
gtgagggaatggtttaggggcatggactattgggcattcatgaaggctggtcccacccaa
cccaaggcttctgaagcccgttcttattggagctagccgtgctatgggagtgagatcaaa
tgagattttttctgggcatctagcatgtatgaggctggggaatgcagagatggtcccatg

 1.21 Term +  38206  38342  137  2  2   78   44   303 0.998  23.08
tgggatggggctggagaggcatgaagctggaggggcaccactgctttagaggccagattt
ttctggaggggattcctctacacatgctacctccagttagcaggaggggaaggaagggtt
gggagtcttggggagtctcaccatcaactcctcctcctgctgctgttccatttgcctcag
ACATGGAGTTGGAGCTGCTGCGGGGCAGCCAGGCCATCATGCTGCGCTCAGCGGACCTGA
CAGGACTGGAGAAGCGTGTGGAGCAGATCCGTGACCACATCAATGGGCGCGTGCTCTACT
ATGCCACCTGCAAGTGA
tgctacagcttccagcccgttgccccactcatctgccgcctttgcttttggttgggggca
gattgggttggaatgctttccatctccaggagactttcatgcagcctaaagtacagcctg
gaccacccctggtgtgtagctagtaagattaccctgagctgcagctgagcctgagccaat

Predicted peptide sequence(s):


>LAMB3_1|GENSCAN_predicted_peptide_1|1128_aa
XLPGLLHAQQACSRGACYPPVGDLLVGRTRFLRASSTCGLTKPETYCTQYGEWQMKCCKC
DSRQPHNYYSHRVENVASSSGPMRWWQSQNDVNPVSLQLDLDRRFQLQEVMMEFQGPMPA
GMLIERSSDFGKTWRVYQYLAADCTSTFPRVRQGRPQSWQDVRCQSLPQRPNARLNGGKG
SCFCHGHADRCAPKPGASAGPSTAVQVHDVCVCQHNTAGPNCERCAPFYNNRPWRPAEGQ
DAHECQRCDCNGHSETCHFDPAVFAASQGAYGGVCDNCRDHTEGKNCERCQLHYFRNRRP
GASIQETCISCECDPDGAVPGAPCDPVTGQCVCKEHVQGERCDLCKPGFTGLTYANPQGC
HRCDCNILGSRRDMPCDEESGRCLCLPNVVGPKCDQCAPYHWKLASGQGCEPCACDPHNS
LSPQCNQFTGQCPCREGFGGLMCSAAAIRQCPDRTYGDVATGCRACDCDFRGTEGPGCDK
ASGRCLCRPGLTGPRCDQCQRGYCNRYPVCVACHPCFQTYDADLREQALRFGRLRNATAS
LWSGPGLEDRGLASRILDAKSKIEQIRAVLSSPAVTEQEVAQVASAILSLRRTLQGLQLD
LPLEEETLSLPRDLESLDRSFNGLLTMYQRKREQFEKISSADPSGAFRMLSTAYEQSAQA
AQQVSDSSRLLDQLRDSRREAERLVRQAGGGGGTGSPKLVALRLEMSSLPDLTPTFNKIC
PCENPTPPAIPTLVLLTVSSVVAKETSFWSLALMEMSGCFWCLVVMEMSGCWFPRAGGAF
LMAGQVAEQLRGFNAQLQRTRQMSVCQQIRAAEESASQIQSSAQRLETQVSASRSQMEED
VRRTRLLIQQVRDFLTDPDTDAATIQEVSEAVLALWLPTDSATVLQKMNEIQAIAARLPN
VDLVLSQTKQDIARARRLQAEAEEARSRAHAVEGQVEDVVGNLRQGTVALQEAQDTMQGT
SRSLRLIQDRVAEVQQVLRPAEKLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQQLA
EGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMD
RMKDMELELLRGSQAIMLRSADLTGLEKRVEQIRDHINGRVLYYATCK