GENSCAN 1.0	Date run: 14-Jan-104	Time: 15:43:18

Sequence KHDRBS1_1 : 32381 bp : 43.65% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    918   1688  771  1  0   52  110   605 0.595  50.55
tcggcagtcttttacttccttacttcggtgaccgccccccaccccactccccacagcctc
cctccactgctcagccgttggagagggcgtggccccgcgagtaacaggtctcccgcccca
cactccgcgggcccgcgcgcagacaaagacattccacagctcccgccccctccacgccag
AAAGGGGAGGAGACACGTGTTCCGCTAGCGCCGAGTCACGTGGAAAACGAAACGAACGGA
GCCCACTGCCTCCCGCGCATGCGCATCAAGCTCTGGCCTGGCGGGAGCGGAGGGAAAGCC
AGAGTCGGGAGGCGACTTCTCGGACGCCGCGGCGGTGCGCAGGCGCCGTGGCCGGACTGG
GGACTTTGTTCTCCGCGGAGAAACCCAAGGGCGGTGCCGGTGGCTGGCTGCGCACGCGCG
CCGCCTCATTTCCGGTGCTCTCTCTCGCTGGGTCGCTCGGGTCGGCTTCGGTCGCTACCG
CTCCCGCTCTGCCACCCCCGCCAACCGCCGCTCGGGCCTCCGTCGCTGCCGCGTCGCTTT
CTCGCTCCTTGGATCGCACATCCTCCCAGATGCAGCGCCGGGACGACCCCGCCGCGCGCA
TGAGCCGGTCTTCGGGCCGTAGCGGCTCCATGGACCCCTCCGGTGCCCACCCCTCGGTGC
GTCAGACGCCGTCTCGGCAGCCGCCGCTGCCTCACCGGTCCCGGGGAGGCGGAGGGGGAT
CCCGCGGGGGCGCCCGGGCCTCGCCCGCCACGCAGCCGCCACCGCTGCTGCCGCCCTCGG
CCACGGGTCCCGACGCGACAGTGGGCGGGCCAGCGCCGACCCCGCTGCTGCCCCCCTCGG
CCACAGCCTCGGTCAAGATGGAGCCAGAGAACAAGTACCTGCCCGAACTCATGGCCGAGA
AGGACTCGCTCGACCCGTCCTTCACTCACGCCATGCAGCTGCTGACGGCAG
gtaagggggcctcccgtgtccctctgggtcgcccggccatcccgggcatgagtggccctg
gctttgttcctctcgcttcccgccccctcgggaccgaggcagtcgggagttccggtctca
tcctcatttttgggagcctggattccacattcccacctcagcccggagtgcgtgggagaa

 1.02 Intr +   2046   2145  100  1  1   64   78    66 0.361   2.37
gaatttctaggctgcagtggaggcccgaaggcgactttgcgatcccctagcgctaatgtc
ttgatggatagtgctgagctccccgcccctttcccgactcttccctcctccctcctcttg
cggctgccgggcgcgcagattcttccagaaatgaaccttcatttccccctttccctgaag
GGAAACCCTTTTTGATCGCGGGTGGCGATGAGCGCCTCGACCGAGGTGTAGGAGGTGAAG
ACAGCCAGAGCGGGGAGGGACCGTGGGAGGAAGGGCCGAG
gtgaggtggggtgaggctggaatgccctgtccagtgccttgctgtcgctggggccgagcc
ggacttagcggtaaccgcagcttaagttgctgggaggaaggagcgatttatgtggatcgg
agcttgaggtttccgaatcagatttccgactaaggctgataaaataagaattgctactga

 1.03 Intr +  17580  17733  154  0  1   69  116   101 0.290  11.07
agagtacacttcttttattagaagcaggctttgggctttctagtcaacttcatatagctt
tagtgctttcagctagtttctttctgaaattggcacatttgtgtgaactatttggtttca
ctatatggtattccatgttattgctttaagcagacttcaaaatttgcatttatttaccag
GGCAAAAATAAATTGTTTTTCCTATTCAGAAATTGAGAAGATTCAGAAAGGAGACTCAAA
AAAGGATGATGAGGAGAATTACTTGGATTTATTTTCTCATAAGAACATGAAACTGAAAGA
GCGAGTGCTGATACCTGTCAAGCAGTATCCCAAG
gtaaggcaaaaagtgctttggatctttgagttatctttatagttatgagagagtcatggg
ctataataaagactcctggggattgtgatgctttagaaacttaagcctgtgaagcttctc
tttcatgcttgtagtacctgttactgagagttgaaatatctaagttcttaactaataaca

 1.04 Intr +  18835  18951  117  0  0   29  121    40 0.745   2.06
ctttctagtttcataaccttaagctaatcactttattaatatggcttcagtgtccttcag
taaaatgggaatggtaatactctacctttgcagggttgtttaaaatcaagtgaggtaatt
tatgtggaaatgtttttatatagtagcatgtatatttagaaatcctctattttctgtcag
TTCAATTTTGTGGGGAAGATTCTTGGACCACAAGGGAATACAATCAAAAGACTGCAGGAA
GAGACTGGTGCAAAGATCTCTGTATTGGGAAAGGGCTCAATGAGAGACAAAGCCAAG
gtaagctcacattagtgaggcaagaggacatcctaatgccttctacttgcccagaatgca
gtatggatgtcttatagaggcggcaagaattttgtatgtgtacagaatgtggctccttta
agtttgcactggatgcaagagattatacaccaagttaatttacttggcttggcaaccctg

 1.05 Intr +  20499  20645  147  2  0   79  107   179 0.998  19.33
ctttactgtttttcttttttcttttttctttttttgtttaattcttctcagctcatacca
attaactttactgtttttcatggacattaggggtatttcttgctgttcctttggcttaga
ggtaaaggtggtgttttctccctagtccatggtgtgacatttctctgcatttttccatag
GAGGAAGAGCTGCGCAAAGGTGGAGACCCCAAATATGCCCACTTGAATATGGATCTGCAT
GTCTTCATTGAAGTCTTTGGACCCCCATGTGAGGCTTATGCTCTTATGGCCCATGCCATG
GAGGAAGTCAAGAAATTTCTAGTACCG
gtaaggaaatccatatcctgtgtcttctgagcaaaagagaactgggatcttatactgttg
tgaaggtaggggttcttaactaaggtctctgcataacctgtatgtataccaaattctgca
cttatgttcattttccttaggtagttcgttacttgcacctagttctcaaagcattatgct

 1.06 Intr +  24221  24354  134  1  2   88   98    64 0.996   6.84
caagacttttctcaaagaggtgacagatagggtgccatttgacttcagagaaggaatgac
ctgagacctcatctgggctctcaagagctcttcttagaattcaagtctcccgtggaccag
atgatttctcagtagaaagtgtagataccacacaatactccttgtatctttcgttcccag
GATATGATGGATGATATCTGTCAGGAGCAATTTCTAGAGCTGTCCTACTTGAATGGAGTA
CCTGAACCCTCTCGTGGACGTGGGGTGCCAGTGAGAGGCCGGGGAGCTGCACCTCCTCCA
CCACCTGTTCCCAG
gtaaaaataatggagacacccagaaataggatgtgaatttgactactagtgtcatctctt
ttagtggtgctcttatgtctagcttaggaagggtctcaggatttgtatgttgcataaaga
acagaattctacaaccatactctcacacctgtaatcccagcactttaggaggctaaggca

 1.07 Intr +  25146  25347  202  0  1   46   55   142 0.990   5.99
tataggacctgggggatcttgcagtgtgggtcctttaccctgtacattcctctgtgcttt
aataatagcctagttaaggcttcataaaatctgcctaattccagaatttgtaaacaaatc
agaacataaaagtggcctgtttataaaaagctccatttaagataaactttcattttgtag
GGGCCGTGGTGTTGGACCACCTCGGGGGGCTTTGGTACGTGGTACACCAGTAAGGGGAGC
CATCACCAGAGGTGCCACTGTGACTCGAGGCGTGCCACCCCCACCTACTGTGAGGGGTGC
TCCAGCACCAAGAGCACGGACAGCGGGCATCCAGAGGATACCTTTGCCTCCACCTCCTGC
ACCAGAAACATATGAAGAATAT
gtaagaaatttgaacaatgtgccatttcccagtacctagaaggctgctaaaggaagttga
atgacagggcctcggtcctttatgtaggtgtcatggactgcctgtaagatttgcaatctg
ccctcttctcttgcagtgaatgttgaactattagaagatttttccattttaggcagggtt

 1.08 Intr +  25863  25930   68  2  2   96   96   105 0.999   9.80
gttttctttgtttagtaaccctttctcttttgactattctacagtaggcattaacatttt
ggagggaaatgtcatgtccttttaattcagaagcctacttactcccatgggatgtaatta
cctttcctactctctatgattttgatcttttatttcatttttttgttgttgttgttctag
GGATATGATGATACATACGCAGAACAAAGTTACGAAGGCTACGAAGGCTATTACAGCCAG
AGTCAAGG
gtgagtcaggcagtataagcactgttttttgtcctgaggatggatggagggagttggagg
aacagagagatttagacagtacaaccctaaggagcagaatggttcgccttttgagggtat
ctcctctgcaacccccacagtcctgactggtcttgaactcttgagctcaagcagtcctcc

 1.09 Intr +  26826  26884   59  0  2   98   80    41 0.997   2.83
attttataagtacatagtctatacatattttggaaatactttacggtttagggatggggc
agaatgagtattttcctgtattaatacacttagtaaaatgactgacttatggaagtattt
gagagaaagttgaaacatagttactctgtagcttcctaacactctgcctttggctttcag
GGACTCAGAATATTATGACTATGGACATGGGGAGGTTCAAGATTCTTATGAAGCTTATG
gtatgtctttatctctgtggtggggcagaatgtacaagtaagtgcctgggagaatgctgg
tgactaaagtattgagagtcagacaaacacacctacggataaacctttagaaggccaaga
ttttgctagatgtgacagtaagagttctgctcttgcttaaattttgcggtacatggtaga

 1.10 Term +  29838  29935   98  1  2  137   42   108 0.996   9.23
aaaattgcccaggctgcccaagagggccaagccaagtagagagcaaggaacaccagggga
agtgtcaagacattagaagaaactcagtgtttttggtgatctttactatgtgacctatcc
ctgcttatccctaagtgctgtcgccacatggtttataaactgtctttgttttccccacag
GCCAGGACGACTGGAATGGGACCAGGCCGTCGCTGAAGGCCCCTCCTGCTAGGCCAGTGA
AGGGAGCATACAGAGAGCACCCATATGGACGTTATTAA
aaacaaacatgaggggaaaatatcagttatgagcaaagttgttactgatttcttgtatct
cccaggattcctgttgctttacccacaacagacaagtaattgtctaagtgtttttcttcg
tggtccccttcttctccccaccttattccattcttaactctgcattctggcttctgtatg

Predicted peptide sequence(s):


>KHDRBS1_1|GENSCAN_predicted_peptide_1|616_aa
XRGGDTCSASAESRGKRNERSPLPPAHAHQALAWRERRESQSREATSRTPRRCAGAVAGL
GTLFSAEKPKGGAGGWLRTRAASFPVLSLAGSLGSASVATAPALPPPPTAARASVAAASL
SRSLDRTSSQMQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGG
SRGGARASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAE
KDSLDPSFTHAMQLLTAGKPFLIAGGDERLDRGVGGEDSQSGEGPWEEGPRAKINCFSYS
EIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRL
QEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHA
MEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVG
PPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYE
EYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPP
ARPVKGAYREHPYGRY