GENSCAN 1.0	Date run: 14-Jan-104	Time: 17:47:31

Sequence KCTD3_1 : 56588 bp : 36.08% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.03 PlyA -    112    107    6                               1.05
 1.02 Term -    816    655  162  0  0   42   36    97 0.576  -3.15
 1.01 Init -   1604   1218  387  2  0   32    7   530 0.835  36.15
 1.00 Prom -   4745   4706   40                             -10.25

 2.01 Init +   7041   7110   70  2  1   66   86    35 0.823   2.36
attactatgagcttaaaaagagataatacaggattggatatttagaaaaactattacagg
gaaggtaaaacctgagtggtatcaagaaagatggacggatcttgaattattggacatgaa
gagagtgatctagctgaataaagataccaaaatggtagtaagcatgaattttttggggat
ATGAAGAAGTTTTGTCCTATTAGAGGGGAAAACCAGCATTTGTACTGGAGAGATGAGATG
GAACCTGAAG
gtaattttgaatgttatactgagaagttgagacttggtgtgatgggctaattgttgattc
ttcagcagagattagcttattggaaagtagtgttttaagatgcattatatggcggataac
aagttgtttattgttattgagagctgcttgtataatcttaactctgaattgaaagtagca

 2.02 Intr +  12659  12796  138  0  0  110   87   119 0.990  13.51
ttttttcattttcattttattttttaattgtaattaaattatttgtaataatttgctata
ttggaagatgtatttcggctttaatgaaattcacatttttgtttctttgtcacaatgtga
tatttttaatttttgaaaggtgaacttaggaatgtatttgttttcttcttctctttatag
GTATTCCTAGTCGTAAAATAAACAACACAGTCAGATCTGCTGATTCTAGGAATGGTCTAA
ATTCTACAGAAGGTGAAGCCCGGGGAAATGGTACACAGCCTGTTCTCTCTGGAACGGGAG
AAGAAACTGTTAGGCTAG
gtaagcaaagattacagaaatagaaaaagaaaaatacgtatgtttttagtgctgggtgat
attgagtaattacttttaaagatttttgcctcatctccttttttatccagatttatcatt
tatatcttggaaaggtctcatttaacacttaatttttatttaaaatgttgtgtaatcttc

 2.03 Intr +  13568  13658   91  0  1   55   72    51 0.799  -1.67
acctcatgatccgcccgcctcggcctcccaaagtgctgggattacaggtgtgagccactg
tgcccggctcttaacaaaactattaaccaaaacaggcagaaggctgaaactggcctggtg
gctgtaatttgccaacccccggtttagaatgtaaaatatttctttttccaaaatcaacag
GATTTCCTGTGGATCCACGAAAGGTGCTAATAGTAGCTGGCCATCACAACTGGATTGTAG
CTGCATATGCCCATTTTGCTGTGTGTTACAG
gtagtgtataattaataatgctttgcttttacaggtggcagtttgaaaattaattgtgat
tttatatttttagattgaaaagctatttttttttagtcatcaagttttttccctgcatat
tttacccatgtctgtatcatctgattaagatttagtgtacttttattttcacagctaatt

 2.04 Intr +  20154  20344  191  0  2  109   54   136 0.898  10.61
ttgtggcttcataggcaatatagatcaacaaaattttatttgtaataggaaggtggatgg
gtaactgtttagttttttttttgttttttgttgttgttttttgtttttggtgcattgatg
tgtattccgtttgcttcattgctgctgagtctaccttatgtgcctgttcttccttaacag
AATCAAAGAATCTTCAGGATGGCAGCAAGTGTTTACGAGCCCATATTTGGATTGGACTAT
CGAACGAGTAGCTTTAAATGCAAAGGTGGTTGGAGGGCCACATGGAGACAAAGACAAAAT
GGTTGCTGTTGCCTCAGAGAGTAGCATCATCTTGTGGAGTGTTCAGGATGGGGGAAGTGG
AAGTGAAATTG
gtaggaagaatcttgtttatgttgcaatttgatgatattaatattttgaagtttataaaa
gagattgacactgaatatgaaaattaacctggactgtcagttagctagagctgtcacagt
atttaatgtgggaggaatgatctgataatgaaggaaaaatgatgttttagaaaagacatg

 2.05 Intr +  27959  28012   54  0  0   63  105    34 0.546   0.63
aagtgctgggattgcaggcatgagccatcatgcccggccgattataacatttttaagctc
aagtgatcattgaaacatttagcttagaccctatttcgtagttgagataagaaccaaaaa
agtggcaaacaaaggtactctgagagccaggatcccaaccctggttctcctgactcctag
TGCAGTACTCTGCTAAAGAGAGACAAGTGTATAAGGCCAATATGCCGCACCAAG
gtgagcctagaattctctgcttaggcattgctgggtcttttgctactgatgtgtgatagg
tgctgcttacaacctctctcacctacacttactcttctgtttgctctgattccctgagct
tgcccatattcagtctcccaatttgatggactcctattaacctttaaaaactccaactca

 2.06 Intr +  29014  29129  116  2  2   80   92    72 0.979   6.05
agttctgtaagctgcttaagagcttgtgagtttcttatttctagtccccaacacgtatag
cacatagtttgtagtaatgagaatataaattagtcacctttaagatgtttttaatccagg
ttttgattaattctaaaaatggtgactgattaacctttttattttttattgtcatttaag
GAGTGTTCAGCCTGGGTGTTCCTGTAGATGCTCTCTTCTTTATTGGTAACCAGTTGGTGG
CCACGAGTCATACAGGGAAAGTGGGAGTGTGGAATGCTGTCACTCAGCACTGGCAG
gttagtttaaagcatattacagaagtgaaaatatttctgaaatgtatgctgattatgtat
tttttttttccttgtagaattcgtactgtttctggttttggttatacaaatattgaataa
atgtagtggtaaatttttttgctagatgcatatttgagcatattttcaagagtttaagtt

 2.07 Intr +  30450  30584  135  2  0   92   42    82 0.739   3.84
ttggtggaagaaagctaggttgcaggaaatgaggaagtaaaagatcagagaagagagaca
gcaaattcaaatacctttcaagaagtttggtggtgaaggaaagcagagaatccaagtgat
agcttaaggatcaaggctggtttgaaaaaaaagataattggtgctttatttttcctctag
GTTAGGACAGGCTTGAGCACACTTGTAGCTAGAGAGGAGAGTTGCCAGAAGGACCTGAAG
ACTGAAAGAATGGAGATTATTTCCGGTCCCATAAAAGTCAAGAGTGTATATGGGATCTAC
AGCACAGCTAGAAAG
gtttgacccaacagggagtagagacatttctttctctgtgacagaagggtaaggaaggag
taaagagaaagacgttgaagaatattatcaaatactgcagagattaatcgtacatttgca
gtagacctgggatcccatgtagttctttagttacataatcaaggtagattttaagtattt

 2.08 Intr +  35525  35612   88  1  1   41   97    20 0.772  -3.18
tagcatgtttgtgtatatgtgtgtgcacgcgtgcacctaaagaaagtttatttcctaagc
cctactaaaattggatattggttgcctctttaccagaagaatcaaagttttgaggaaatt
gaccagaaaatagaaattataattactatctaacatctgataatactctcactacatcag
GTTCAAGATGTTGTTCCTATAACTAGTTATGACACTGCTGGATCATTCCTTCTGCTTGGA
TGTAACAATGGATCAATATATTACATAG
gtaagtgttcagtcacttaaaatgctcctgcttaatgtaattttttaaatgagaacaaga
aaacattacctttcagttttaaatagatatgctatttattttaatgctgtttaaaatttt
tatgttttagatatgcagaagttccccttgcgaatgaaagataatgatcttcttgtaact

 2.09 Intr +  35743  35859  117  2  0   70   32   111 0.724   3.22
tggatcattccttctgcttggatgtaacaatggatcaatatattacataggtaagtgttc
agtcacttaaaatgctcctgcttaatgtaattttttaaatgagaacaagaaaacattacc
tttcagttttaaatagatatgctatttattttaatgctgtttaaaatttttatgttttag
ATATGCAGAAGTTCCCCTTGCGAATGAAAGATAATGATCTTCTTGTAACTGAACTGTATC
ATGATCCTTCAAATGATGCTATTACTGCTCTGAGTGTTTACCTCACACCCAAAACAA
gttagtacatggccaattatatacattcttgactttttatctttttattcattagtttat
tatgtgactaggtcaaattaaactggtttatttctttttgagaactgcagtgcctaagga
tttcatctctactaagtctaaaatttgtattcagttttatactgaagtcaaacatgacca

 2.10 Intr +  37790  37960  171  0  0   67   98   132 0.997  11.09
aataatgattttaagatgaccggagaagtcttaagatttttttttttactgaactggatt
tggggctgatataaacagtgaatccagctctgcctattttatcatagggaagctttgcga
gggtagcttttttattatcgttccataatgtatcacctgtcaactcttgactttatatag
GTGTCAGTGGTAACTGGATCGAGATCGCCTATGGTACGAGCTCTGGAGCAGTACGAGTGA
TTGTACAACACCCAGAGACAGTTGGGTCAGGTCCTCAGCTTTTTCAGACTTTCACAGTTC
ACCGAAGTCCCGTAACAAAAATCATGCTATCAGAGAAGCATCTTGTATCAG
gtaaaatgatttcattatactggtaaggaacttggctctgtgtgttattttcattaaaag
aatgaaaacgcagtgtttatgtgagaaaaatatactaaaagaagtactagaaaagtttaa
tgactgaagaaattatgattgtcttttaaagatttctttgagctggtcgtggtggctcat

 2.11 Intr +  41675  41830  156  0  0   79   80    79 0.927   5.26
aaggtaaaacatccagttttctcacttttgttaagtagtcacaaatcaagtatagtttta
agataaatatgtcatttgccacttatactctgatctgtgtaatatagatgatagtgaaaa
aagttaaaatgagtttttaaaagtaattttgtattcttttgtgttctctttctctgctag
TCTGTGCAGATAATAATCATGTCCGGACGTGGACAGTAACACGATTCAGAGGAATGATCT
CTACTCAGCCAGGTTCTACTCCTTTAGCGTCATTCAAGATACTATCCCTGGAGGAGACAG
AAAGTCATGGTAGCTATTCCTCTGGAAATGACATAG
gtgggttaggttattttagggcatttttaggtactatattaactgttcagaagaagcata
tcaactaataaaaccacaaaaatgagttttaaatacaaattttccattttaattttgaaa
ttctaaacagaattttagtgtgtttttctgattaaattctataaattcacaaaattattt

 2.12 Intr +  45483  45579   97  1  1   67   87    75 0.997   3.45
tctaatgcaaattgaagtacttgtatacatttattgcatgtctgatgttgagctgaaatg
tgataccatattggtacgtataagaaattcttttcttatattaatattaatgttcctttt
gtaaaatgagaaaaaataaaattttaattaattttttgacatttttgttttctgatcaag
GACCTTTTGGAGAGCGAGACGATCAACAGGTGTTTATCCAGAAAGTTGTTCCCATCACCA
ACAAACTATTTGTAAGACTCTCATCGACTGGAAAAAG
gtaacactttattgtaaaaatatttgtattcagaagccaccttttgtcttacaaaacata
tggcataatttgacatattgaccaaagagtgctactagaaacaaattgttgggacagaag
tctgttatctcataatcataactcaaaattaagacagtagactttatgcttactttctgg

 2.13 Intr +  52544  52728  185  2  2  123   73   123 0.996  12.81
agctgtatattttttctggtttcagattttaaagatttacacataaattttaaatgattt
tttaaaagtcttttctagtataacatgtttgctttctttctttctgtctttttagtttca
tagcttctttttaaataattgctcattcccatcagggctctttctgcttttcttttgcag
AATATGTGAGATCCAGGCTGTTGACTGTACTACAATATCCTCATTTACAGTGAGGGAATG
TGAGGGATCCAGTAGGATGGGCTCAAGACCAAGGCGCTACTTGTTCACAGGCCATACAAA
TGGCAGTATTCAAATGTGGGATCTGACCACTGCTATGGATATGGTTAACAAAAGTGAAGA
TAAGG
gtaggttctcatacagaaagatgtttgtcacaaggttaagcttttcacttaagtgatttt
aatgactatttgttctcctaagatgtaggtggtccaaccgaagaagagctactcaaatta
ctcgatcaatgtgatttgagcacatctcgctgtgctactcctaacatcagtccagcaact

 2.14 Intr +  52811  52949  139  0  1   78   82   128 0.925   9.80
accaaggcgctacttgttcacaggccatacaaatggcagtattcaaatgtgggatctgac
cactgctatggatatggttaacaaaagtgaagataagggtaggttctcatacagaaagat
gtttgtcacaaggttaagcttttcacttaagtgattttaatgactatttgttctcctaag
ATGTAGGTGGTCCAACCGAAGAAGAGCTACTCAAATTACTCGATCAATGTGATTTGAGCA
CATCTCGCTGTGCTACTCCTAACATCAGTCCAGCAACTTCCGTAGTTCAGCATAGCCACT
TACGAGAATCAAATTCTAG
gtaggttaaagagttgggtattataaacaaaatttatttcttttggggaaattgactgaa
atattgtaatcacatagttgttctagaaagccatacttctcaaggtacattttaaattca
gacattatgttaactttttaacagttttaccaaatttcttgataggcatatctggttctt

 2.15 Term +  53715  54276  562  0  1   46   48   416 0.996  26.26
aattttatataccatctatataataaagagtacttgataagtatatttttacaaagagaa
atatggatataatacactttatgtatttatatagtgtgttttattggttgtataattaat
atgttcctgagaaatcacagagtgaaatctgaactgtcatttttaaaaactgtatttcag
CCTTCAGCTTCAGCACCATGATACCACCCATGAAGCAGCTACTTACGGTTCCATGAGGCC
TTACAGAGAAAGTCCTTTATTAGCAAGGGCAAGAAGGACTGAGAGCTTTCACAGTTATAG
GGACTTCCAGACTATTAATTTGAACAGAAATGTAGAAAGAGCTGTCCCTGAAAATGGTAA
CTTGGGTCCAATACAAGCTGAAGTGAAAGGGGCAACAGGGGAATGTAATATATCTGAGAG
AAAGTCTCCTGGAGTAGAAATAAAAAGTTTGAGAGAATTGGATAGTGGATTGGAAGTGCA
TAAAATAGCTGAAGGTTTTTCAGAATCCAAGAAAAGGTCATCAGAAGATGAAAATGAAAA
TAAAATAGAGTTTAGGAAGAAAGGAGGATTTGAAGGGGGAGGATTCCTTGGAAGAAAGAA
AGTTCCCTATCTGGCGTCATCACCAAGTACTTCCGATGGAGGAACTGACTCACCTGGTAC
TGCGTCCCCATCTCCTACAAAGACTACTCCATCTCCTCGGCATAAAAAAAGTGATTCTTC
AGGTCAGGAGTACAGCTTGTGA
aaactcaccaaaatgaatagttgtttcgttacatttagatgaaagttaaactttactgaa
tttcagtacattagtttttacactaaaactttacaagataaaattggacttcatttagta
tctttttaacagaattacttggaataatgagatacaataatcatatctcttttgacattt

Predicted peptide sequence(s):


>KCTD3_1|GENSCAN_predicted_peptide_1|182_aa
MLHQLQNPPDVLAAWRPPRSPPGLASHARPRSCDSRSPSTPKEEAAKASPLQARYPPTHL
VPPTFSWTISPLPAAAAGKLPQCPPAISGGSGRARRPPSPAGTAEPGAVARGSGDGCRAS
GAAAAGGRGPLSLLHFRFSKTRKLIRRLRADLGKRSTDLYDPLCQHGLGKEKLILEVVKV
DA

>KCTD3_1|GENSCAN_predicted_peptide_2|769_aa
MKKFCPIRGENQHLYWRDEMEPEGIPSRKINNTVRSADSRNGLNSTEGEARGNGTQPVLS
GTGEETVRLGFPVDPRKVLIVAGHHNWIVAAYAHFAVCYRIKESSGWQQVFTSPYLDWTI
ERVALNAKVVGGPHGDKDKMVAVASESSIILWSVQDGGSGSEIVQYSAKERQVYKANMPH
QGVFSLGVPVDALFFIGNQLVATSHTGKVGVWNAVTQHWQVRTGLSTLVAREESCQKDLK
TERMEIISGPIKVKSVYGIYSTARKVQDVVPITSYDTAGSFLLLGCNNGSIYYIDMQKFP
LRMKDNDLLVTELYHDPSNDAITALSVYLTPKTSVSGNWIEIAYGTSSGAVRVIVQHPET
VGSGPQLFQTFTVHRSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLA
SFKILSLEETESHGSYSSGNDIGPFGERDDQQVFIQKVVPITNKLFVRLSSTGKRICEIQ
AVDCTTISSFTVRECEGSSRMGSRPRRYLFTGHTNGSIQMWDLTTAMDMVNKSEDKDVGG
PTEEELLKLLDQCDLSTSRCATPNISPATSVVQHSHLRESNSSLQLQHHDTTHEAATYGS
MRPYRESPLLARARRTESFHSYRDFQTINLNRNVERAVPENGNLGPIQAEVKGATGECNI
SERKSPGVEIKSLRELDSGLEVHKIAEGFSESKKRSSEDENENKIEFRKKGGFEGGGFLG
RKKVPYLASSPSTSDGGTDSPGTASPSPTKTTPSPRHKKSDSSGQEYSL