GENSCAN 1.0	Date run: 14-Jan-104	Time: 17:36:20

Sequence IL24_1 : 9095 bp : 48.15% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   3120   3272  153  2  0   36  101   101 0.252   4.20
cggtttgcaatagtctcaacttgcccattggagagtgctcgagattggcccggggagacc
ctcggagcattttcccagggcatgtaactctgggtcagagggccggcctcacaggctgcc
tccctttctttcagcagacccttctgccctcctttgctggcgacagcctctcaaatgcag
ATGGTTGTGCTCCCTTGCCTGGGTTTTACCCTGCTTCTCTGGAGCCAGGTATCAGGGGCC
CAGGGCCAAGAATTCCACTTTGGGCCCTGCCAAGTGAAGGGGGTTGTTCCCCAGAAACTG
TGGGAAGCCTTCTGGGCTGTGAAAGACACTATG
gtgagtaaagtgctgttctggacccagtcgtgggggttcctgggggcagtgggccagtgg
ggcgaggggatgctattttatgattctggagtccttcacagcttgctaatcagtttccag
tttcccatataataactctgtgaggtcagaaggcaccacaagccccatttacacatgagg

 1.02 Term +   6733   6816   84  0  0  112   42   118 0.986   7.25
aagcagataaacacatgtagatggaggaaaagtgacaggcaggtgggttcatcagtgggc
tcatcccaaaggtgacccatcccttggattggagtcaggtctattttaggcatggcaggt
tggaagaaagactattctcatagctaacatggctgaccttcaaccctcttttccctttag
TTGGACGTAGAAGCAGCTCTGACCAAAGCCCTTGGGGAAGTGGACATTCTTCTGACCTGG
ATGCAGAAATTCTACAAGCTCTGA
atgtctagaccaggacctccctccccctggcactggtttgttccctgtgtcatttcaaac
agtctcccttcctatgctgttcactggacacttcacgcccttggccatgggtcccattct
tggcccaggattattgtcaaagaagtcattctttaagcagcgccagtgacagtcagggaa

 2.02 PlyA -   7228   7223    6                              -0.45
 2.01 Term -   8904   8776  129  0  0  111   48   127 0.992   9.18

Predicted peptide sequence(s):


>IL24_1|GENSCAN_predicted_peptide_1|78_aa
MVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMLDVEAALTK
ALGEVDILLTWMQKFYKL

>IL24_1|GENSCAN_predicted_peptide_2|42_aa
VSESPWLHAPSLKTSCEYVSLYHQPAAMMEDSDSDDYINVPA