GENSCAN 1.0	Date run: 14-Jan-104	Time: 20:07:28

Sequence IL22RA1_1 : 25750 bp : 48.71% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1240   1282   43  0  1   73  105    82 0.991   8.63
tccagagcacacagggccaggacacctttgtacccctgctccccaccggcacaggtccca
cccacccccttctccccgccccatgcccgggtggagccagctgccagggcgccaagactc
ccagccctctctctgtgcacggcagagtagaggccaagggagggctctgtgccagccccg
ATGAGGACGCTGCTGACCATCTTGACTGTGGGATCCCTGGCTG
gtgagtgcccatctaccctgtggtcagacctcccttatcccaggggccaacgatcagggt
catctccccagcaccctccccagcccgagcatagccagtttcagtttctcccctgctagg
gctgagcagggtgccgggtgttcacggagaagcaaatgcccagcttagtttgctgggggc

 1.02 Intr +   5608   5740  133  2  1  116   29   210 0.995  17.60
tgctggtccatttgtagaaggctgggggccagggtctccctgcccacccaccaggctggc
atcttgaaagcaaaggcactttgcatgaaatttatatggggcaggactctgactgagccc
atacatgggcagggtgaccctgggaaagcccctgctcaccctcctcccaccctcctgcag
CTCACGCCCCTGAGGACCCCTCGGATCTGCTCCAGCACGTGAAATTCCAGTCCAGCAACT
TTGAAAACATCCTGACGTGGGACAGCGGGCCGGAGGGCACCCCAGACACGGTCTACAGCA
TCGAGTATAAGAC
gtaggcttctctcttgaccccacctcctttgactgatctgaagccagcccctctccaagg
aattcccctcctctccatatgttcccatgtccccaccaggactggtgtcacatagcccct
cccagataaagctttgctcctttatgtttcttttgcagagggagaataatataagggtaa

 1.03 Intr +   7013   7191  179  2  2   98   79   185 0.998  18.16
agaagaatgcatatgcctcagagaatcattgtgagaacaaaatgagatcattcgcataaa
gggcctgggccactgaacgtgctaagtaaatatcagatctccttggcattattaataagc
cacaggcctagcgctggccttttcatcaccacggtgacttggccccttcctgacctgcag
GTACGGAGAGAGGGACTGGGTGGCAAAGAAGGGCTGTCAGCGGATCACCCGGAAGTCCTG
CAACCTGACGGTGGAGACGGGCAACCTCACGGAGCTCTACTATGCCAGGGTCACCGCTGT
CAGTGCGGGAGGCCGGTCAGCCACCAAGATGACTGACAGGTTCAGCTCTCTGCAGCACA
gtgagttggagcccctgtgggtttcaggggagggaagaggaaagcgcaggtgtttgcggg
gtgggatggcctcttcccctctggagtgggtggagggtccagaaggggctctctgcaagg
ggaggggcagctggggatgtggcttttagggaagccccccacccccaccaattacagtgt

 1.04 Intr +   9936  10111  176  1  2  103  101   178 0.936  20.26
ccagggcttgtagaaacttttctcttttcactgtttgtttagccgttgctttcagaagca
tagctggcactggagtggaaggagagagggagcagtcattttccactgtccaaggttgcc
tcagacactacccaccgattctgactttttcttttctcttttctctctccctatccccag
CTACCCTCAAGCCACCTGATGTGACCTGTATCTCCAAAGTGAGATCGATTCAGATGATTG
TTCATCCTACCCCCACGCCAATCCGTGCAGGCGATGGCCACCGGCTAACCCTGGAAGACA
TCTTCCATGACCTGTTCTACCACTTAGAGCTCCAGGTCAACCGCACCTACCAAATG
gtgagtgtatgttgcaccctggtctttctctgcctaggaagcctcttccctcccaattag
atctgagttgctttaagaaaaaaaggggacatgttatgtaaattagcatttcccaaaaca
tgtcccttgagaggctccttgaagcctggaaatcatcacaaatgacaacttttctcttgt

 1.05 Intr +  16043  16181  139  1  1   65  109   114 0.960  11.24
acgtgcttggagactgattggatttggggataaagcagaagggaggggaatggaaacaga
ggctgaagacagacccatcagcatcaaaccagaatccaggaggagcgagcaagcttcctt
gggctctatgtggagatcggtgtgtaacaggaatcacattccattctctgtccaattcag
CACCTTGGAGGGAAGCAGAGAGAATATGAGTTCTTCGGCCTGACCCCTGACACAGAGTTC
CTTGGCACCATCATGATTTGCGTTCCCACCTGGGCCAAGGAGAGTGCCCCCTACATGTGC
CGAGTGAAGACACTGCCAG
gtgagttcggctgaaaccagagggaggtggggctcccgaattcaagtcttgactcttctc
tttcctccctgtaaccaaggtgagacttggcaacactctagaaaaccatggaagggttat
cagtgtgttattgaagtcaatctttgtttatccataaaagagttggctgatgagttatca

 1.06 Intr +  20899  21020  122  2  2   78   93   136 0.974  13.31
ctgactatttagatgtacagtatatggacttccatttgtgatcttgcattctgacggtag
gagaggccttgccagcccagccagagagggttttcagcatccacatgtggggccagaccc
aaccgggcccaggcagagcccagcctcacgcttccttctctggcccctttggtttcccag
ACCGGACATGGACCTACTCCTTCTCCGGAGCCTTCCTGTTCTCCATGGGCTTCCTCGTCG
CAGTACTCTGCTACCTGAGCTACAGATATGTCACCAAGCCGCCTGCACCTCCCAACTCCC
TG
gtgagccatccccccagggtgggagggagaggtccaggggagggcctgggctccgaggtc
cccagttgtccccaaaatgcagggatccacagacaaagcaggagatgggcctgctctctc
cattcacggagctcacagtcccagctaaagtcaacggacgtgtagcccagcaggtctcag

 1.07 Term +  22585  23517  933  0  0   71   55   413 0.838  28.43
ttcagagaggcacttgcacctagaggagtctctgggaagcagatggggatatgggacaga
cgcatcttgaaaaagcccccagatgcctccctatggaggacctcacccacccacatcacc
agtagggagcttgggacttaccctaaccacaggggggtgactgttgtcgtccctgcacag
AACGTCCAGCGAGTCCTGACTTTCCAGCCGCTGCGCTTCATCCAGGAGCACGTCCTGATC
CCTGTCTTTGACCTCAGCGGCCCCAGCAGTCTGGCCCAGCCTGTCCAGTACTCCCAGATC
AGGGTGTCTGGACCCAGGGAGCCCGCAGGAGCTCCACAGCGGCATAGCCTGTCCGAGATC
ACCTACTTAGGGCAGCCAGACATCTCCATCCTCCAGCCCTCCAACGTGCCACCTCCCCAG
ATCCTCTCCCCACTGTCCTATGCCCCAAACGCTGCCCCTGAGGTCGGGCCCCCATCCTAT
GCACCTCAGGTGACCCCCGAAGCTCAATTCCCATTCTACGCCCCACAGGCCATCTCTAAG
GTCCAGCCTTCCTCCTATGCCCCTCAAGCCACTCCGGACAGCTGGCCTCCCTCCTATGGG
GTATGCATGGAAGGTTCTGGCAAAGACTCCCCCACTGGGACACTTTCTAGTCCTAAACAC
CTTAGGCCTAAAGGTCAGCTTCAGAAAGAGCCACCAGCTGGAAGCTGCATGTTAGGTGGC
CTTTCTCTGCAGGAGGTGACCTCCTTGGCTATGGAGGAATCCCAAGAAGCAAAATCATTG
CACCAGCCCCTGGGGATTTGCACAGACAGAACATCTGACCCAAATGTGCTACACAGTGGG
GAGGAAGGGACACCACAGTACCTAAAGGGCCAGCTCCCCCTCCTCTCCTCAGTCCAGATC
GAGGGCCACCCCATGTCCCTCCCTTTGCAACCTCCTTCCCGTCCATGTTCCCCCTCGGAC
CAAGGTCCAAGTCCCTGGGGCCTGCTGGAGTCCCTTGTGTGTCCCAAGGATGAAGCCAAG
AGCCCAGCCCCTGAGACCTCAGACCTGGAGCAGCCCACAGAACTGGATTCTCTTTTCAGA
GGCCTGGCCCTGACTGTGCAGTGGGAGTCCTGA
ggggaatgggaaaggcttggtgcttcctccctgtccctacccagtgtcacatccttggct
gtcaatcccatgcctgcccacgccacacactctgcgatctggcctcagacgggtgccctt
gagagaagcagagggagtggcatgcagggcccctgccatgggtgcgctcctcaccggagc

Predicted peptide sequence(s):


>IL22RA1_1|GENSCAN_predicted_peptide_1|574_aa
MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTY
GERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTT
LKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLG
GKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMG
FLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ
YSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVG
PPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLS
SPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNV
LHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPK
DEAKSPAPETSDLEQPTELDSLFRGLALTVQWES