GENSCAN 1.0	Date run: 14-Jan-104	Time: 19:01:10

Sequence HPCAL4_1 : 14844 bp : 53.43% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.02 Term -    380    198  183  2  0  127   47    98 0.791   7.46
 1.01 Init -   1287   1219   69  0  0   47   52   127 0.755   4.00
 1.00 Prom -   2873   2834   40                              -6.90

 2.01 Init +   7726   7777   52  0  1   83   73    35 0.654   2.77
ggggtggcccaagaaagccttgaggaagaaattgggagacagtgccaaggggacacacaa
ggaacctaccttgggtcccttctcaggacagaagcctgccaaggagggtgggggctgact
tcagaaagccctaaatggcaaggagaggagtcaaggccttagtctgtgggcaggggagcc
ATGAAAGGTGTGAGCAGGAGGGGAGAGGATGAAGACTGTGGCGTGCTGCACG
gtcagtgaggaggagagctgagacctggaaggcgggagacccccggggctaggagaagaa
acctacctgaatgcaggtgttgtgaggggagaggaggccccattatgggggagtgtcatg
aggggaaggaacctgcaaccccgccctgtgtgtggcaggggagggggcagctgtggctga

 2.02 Intr +   8007   8176  170  1  2   89   86   381 0.463  38.18
taggagaagaaacctacctgaatgcaggtgttgtgaggggagaggaggccccattatggg
ggagtgtcatgaggggaaggaacctgcaaccccgccctgtgtgtggcaggggagggggca
gctgtggctgaggcagggcctttccctggacccagtcggaggaatccctctgtcccacag
GCCCCGCCATGGGGAAGACCAACAGCAAGCTGGCCCCCGAGGTGCTGGAGGACCTTGTTC
AGAACACTGAGTTCAGCGAGCAGGAGCTGAAGCAGTGGTACAAGGGCTTCCTGAAGGACT
GCCCCAGCGGCATCCTCAACCTGGAGGAGTTTCAGCAGCTCTACATCAAG
gtgggcggccggcacctggtgtgagggagccaagtacccgggttgggggaggcgaggaac
cgggggtgagggaggcagggcaccctgggatgagaagaggcgaggcacccggggtgggag
gggaggcgaggcacccggggtgcgggggaggtgaggcacccggggtggcgggggcaaggc

 2.03 Intr +   8466   8681  216  2  0   76   64   627 0.999  58.33
cggggtgggaggggaggcgaggcacccggggtgcgggggaggtgaggcacccggggtggc
gggggcaaggcacccggggtgggaggaggcgaggcacccggggtgcaggggaggttccct
gagatgggggcggggtgggcggggctgtcgctgcgccccaacccaccgcacccccctcag
TTCTTCCCCTACGGCGACGCCTCCAAGTTCGCGCAGCACGCTTTCCGCACCTTCGACAAG
AACGGCGACGGCACCATCGACTTCCGGGAGTTCATCTGCGCCCTGTCGGTCACCTCCCGC
GGCAGCTTCGAGCAGAAGCTCAACTGGGCCTTTGAGATGTACGACCTGGACGGCGACGGG
CGCATCACGCGCCTGGAGATGCTGGAGATCATCGAG
gtgcggggccgcgcgggcgctgctgttcccgaggccagcgcttcgccatccccgcccctg
cctccgcgctgctctcgggcttcggggcctccctgctgctccccagcctgcgatcccgcc
tcctaccaccccgctacaggcccgggctaaatgctttacccgacactcgacggggcggag

 2.04 Term +   9885  10082  198  2  0  114   43   346 0.996  30.42
gaaactctgtttcaaaaaaaaaaagagttgctcattaaatatccagtcttaatgaccaca
tataccttccagtatcctcaccaacccccagtgttctccctgccagatccctttccttca
cccgctgcttctcggggccccttgtgggtgttcacacctccctcctccttccctcaccag
GCAATCTACAAGATGGTGGGCACCGTGATCATGATGCGCATGAACCAGGACGGGCTCACG
CCCCAGCAGCGTGTGGACAAGATCTTCAAGAAGATGGACCAGGATAAGGACGACCAGATT
ACATTGGAGGAGTTCAAGGAGGCAGCCAAGAGTGACCCATCCATTGTGTTGCTGCTGCAG
TGTGACATGCAGAAGTAG
aagctggtgaggggcagggtccctggccagaaggggcatggccacctcccaacctgatga
cctctctggctggcctcccaggaggagggacactccagcccccctctctggcccacccag
tcctctgcccaagcccttcctcccctccatcaagatctttgagggaccacctcaccctgc

Predicted peptide sequence(s):


>HPCAL4_1|GENSCAN_predicted_peptide_1|83_aa
MAPSLGGPREPRLARGPAAVLSKTEPVPSRRQSPASDVDTNPRRFTLSGSGSFQGPGNTS
SPHLGVSPQPGPAAWAALASESS

>HPCAL4_1|GENSCAN_predicted_peptide_2|211_aa
MKGVSRRGEDEDCGVLHGPAMGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPS
GILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQK
LNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQ
DKDDQITLEEFKEAAKSDPSIVLLLQCDMQK