GENSCAN 1.0	Date run: 14-Jan-104	Time: 16:25:21

Sequence GPA33_1 : 40186 bp : 47.35% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   7735   7789   55  0  1   79   46   115 0.746   5.94
ctaagctactgccacagctgcctcacttgtctcctgagcctgtttgcccttctcctaact
gctgtccaccctggagccagaatgatcttgtaaaataaaatcatgaccatgtcaccacct
ctgcttaaagcccttccataacttcccatgactattaggataaagactcaaatcgttgtc
ATGGCCGATAAGCGCCAGGCCCAGCCCACATTTCTGGCTGCACTGGCCATGTATG
gtgtgatttgagttgcttgtaagaggatcttggtgggggcaggcaatctggctgaaaggg
tggatagcaggatttgtcctcaactacttggatgagacaaggatgctgtttttacttgtc
ctgtatttggacaagtttatttggattgacagtgggaggctaaaggatatcatatgggga

 1.02 Intr +  18293  18447  155  0  2   80  103   100 0.814  10.49
cctcatcgcagtcttggaggagaagctggttgccagggccaaggtggccaagatggctct
agctgtggctggaggtgcaagaacagccctggacattccctcagtggtcctgtgggcagt
gagtgggtatgtctgtccgtgtcgcttacttttcccttccactgcctactttctttccag
TCAGGGTGACCGTCGATGCCATCTCTGTGGAAACTCCGCAGGACGTTCTTCGGGCTTCGC
AGGGAAAGAGTGTCACCCTGCCCTGCACCTACCACACTTCCACCTCCAGTCGAGAGGGAC
TTATTCAATGGGATAAGCTCCTCCTCACTCATACG
gtaaggatactttacaagttcaggcaacatgggaatgattatcacctgaccaggacctct
tagaaggcaagcactatgaagtctttccataaatggtagaataaacactagcacccaggc
tggagtgggtggggagggagcagtgaatgttgggctcatggagggccagagtatgtcacc

 1.03 Intr +  22694  22910  217  1  1  104  109   313 0.938  33.08
tatatataatacaagaaatccacaaatgggtagcacatatgcgagctatttgttctgagg
ggttggcaggtctgtgcttctgggccctggaaactgggggatgagggtagtcagggcagg
ctggaagcaccaggcaagggcctttgggtgaagacctggtgccatttcttctctctccag
GAAAGGGTGGTCATCTGGCCGTTTTCAAACAAAAACTACATCCATGGTGAGCTTTATAAG
AATCGCGTCAGCATATCCAACAATGCTGAGCAGTCCGATGCCTCCATCACCATTGATCAG
CTGACCATGGCTGACAACGGCACCTACGAGTGTTCTGTCTCGCTGATGTCAGACCTGGAG
GGCAACACCAAGTCACGTGTCCGCCTGTTGGTCCTCG
gtgagtgtcttcatgtctttcaggagttgtaggaagagggtgggcaggtggcagcacagg
gagaagagcccaggtgttgagacgaagccagaggcagcaacaaggagctaagactcctca
cctcgtccaggctgtcttcagcagagggaccgctcctccctttggaactaaacactattc

 1.04 Intr +  24069  24119   51  1  0   67   66    63 0.201   0.88
gagaggtagccaatggcaacacaggtaggtattccatattttcctcatgtcctttcaaca
cacacacactcttgcatacttttctcttttcctttctttcctttaaaaaaaatggaatca
tgttataaagatcactctgcgttttttctttctaaccttgtttcatgcgcatttctccag
ATCGGCACATGCAGATCTACCGATTAACAGCATACATTCCATCACACGGAG
gtaccatgatttattcaagtgttccatactgatgaatattcaggctgttaacattttttt
gtatgaacaatactacaatagacatcccatacacacacgtacatatgtatgttaggggtc
ccttaaataggtctcatttcctttgggcaatggaagtattaatgcacactcccccgaaat

 1.05 Intr +  25042  25130   89  2  2   57   92    28 0.069  -0.21
ccactggggctggatgacctcagtaaaccgaggcgagcatgaagctcccagcccggcggc
ccctcagcccgcgcctcggggcagcacgcgtggtctcagtctcggtttcggctgggaaaa
ctggggctccgggaccggggacccggtgctccggcctctggcgccccctgacgtctgtag
CGGGAGTCGCAGGCTTCGGAGAGGCCTTGGCACCCGACTGGTTCCGTTTCCCCTCCCTCC
CTATCACTGCTCCTCCAGTGAATATTCAG
gtaacatctgcattctgctggggaggtaagactgataatataccgagtcccccggaggtc
tcacgggccccacatgtgtggaaggacgatttgatctgttaaagatctgtttgatcggag
gtcctacctgtttttgacggtggaaggctgaggggagagaccttagtgagggatctggac

 1.06 Intr +  25601  25904  304  1  1   73   99    49 0.527   0.66
ttgtctgtacctctgcctctggagagaattaaggatttgctttcagcagttttcccttag
aaaatggtggtttcagcaaagctataacagtttttggatgcattcggatgcctttgagtg
ctctgtagatgccagtaggcctcagttacttttcttccctttttgtcttttatcccaaag
AAACCTGGTTGTAGAAAGGCTCTACTGTCAGTCATGCACACTTGGTGTGACTTTGGGGAC
ACCTGGGACTCCTCAGGTGGGATTGGTGTTTTGCCCGCTCTCCAATTGTGGAATAAAGCC
TTTGCTTCCGATTCAAGGCATTCCTGGGAAAAGGCTGAATGGTTTGGATGCGTGGAGAGG
GATGCTCCCGTACCTCTGAAAAGCTCAAGAGATAAAGCTTGGCTCAGCAAGCCCATCCTA
GGGGTCCTCTGGGAAGTGGTGTTCACCTTCTCTTGTTCCCCGGGGACCTGCTTGTTGGCT
GCTG
gtaagagtggtccttaagccgcagactccccctccccacactgctccagtcccagggtct
ggtgcaggatagatgaggcccggccttgaactttggacctcttatgtttaggaaccatcc
aagggaaagtgacaatcagggagggcctctaatttccctcatgctcgccccacacctggc

 1.07 Intr +  28095  28250  156  1  0   94  110   195 0.987  22.28
tgaggccatattggggtgaattggttttacagcattccatctcactactcaactatggag
ttttctgcctgtgaacaaacaaggcagtatatgtgtgtggggggtgggtggggaggggtg
ggtggctgtcaccaagccccacctgcctcatgccttctctttggtctctcctctatatag
TGCCACCCTCCAAACCAGAATGCGGCATCGAGGGAGAGACCATAATTGGGAACAACATCC
AGCTGACCTGCCAATCAAAGGAGGGCTCACCAACCCCTCAGTACAGCTGGAAGAGGTACA
ACATCCTGAATCAGGAGCAGCCCCTGGCCCAGCCAG
gtaagggggcagtagggaaggcgggctccccacgtcaaagtgcaacacatgcagctgatt
ggctaggggctgcaacttgggttgaccgatcagatccccctgaaggccgcttgcttccct
acccatccctatccccctatccccacctctctaagcactggtttcttgtttttagacaga

 1.08 Intr +  35983  36102  120  2  0  137   62   150 0.932  17.77
tcacattgtgggccctgcctggtttaagcgtcctgcagccctggaggtggacatggggct
ccggcctgaagaagctcagtggcagaggttgtgcttcccaaggagtccagacctcccatt
cctggctgtctccactccactgtagtgcctctcttcaccctgactcttcttcccctgcag
CCTCAGGTCAGCCTGTCTCCCTGAAGAATATCTCCACAGACACATCGGGTTACTACATCT
GTACCTCCAGCAATGAGGAGGGGACGCAGTTCTGCAACATCACGGTGGCCGTCAGATCTC

gtaagagcagcctgcggggggagggctgacaaacgccacaggataactggtgggggtcca
gaaagtcagctgagaccaccgtgaggaggaataggggaacctctctagggccacgcacct
gcaggttagctgtggtgacctaggcaggatgactctgtcccaggctcccctcactctgag

 1.09 Intr +  36721  36856  136  2  1   78   78   296 0.999  27.23
tgtctctgtctgcacctccatcctgaagaatattcctgggccatggctggtcacattcct
ccaagaccatgcctttcatggagtgttaccagaagctggtagctgctgctcccctggctg
ggaggagacccggagctagcttagaagctcggcaagtgcagctgctctgtcctcttgcag
CCTCCATGAACGTGGCCCTGTATGTGGGCATCGCGGTGGGCGTGGTTGCAGCCCTCATTA
TCATTGGCATCATCATCTACTGCTGCTGCTGCCGAGGGAAGGACGACAACACTGAAGACA
AGGAGGATGCAAGGCC
gtgagtgtctgggctggtagcctgttggaagggtctggggagactggaaatatgcttccc
aattcctcacagcctcttctacttgcagcaccccttggggtatatcacccccattttgtg
ctgatgaaacaatgacctgtccaagccataaaatgtgcattgcagccccaggacctgcct

 1.10 Term +  37366  37498  133  1  1  112   48   123 0.999   8.26
cgtggaacaagtctgtggcacctttactctcagcccagcctttcagcccagtgtcctctg
cagctggtgggtggggaggaggtctggaggctgctcttcctgtaatgcacatgaggccca
gctcccttgagggtccacctgagagcaaatccttcccctctgtcccctgctgccctgcag
GAACCGGGAAGCCTATGAGGAGCCACCAGAGCAGCTAAGAGAACTTTCCAGAGAGAGGGA
GGAGGAGGATGACTACAGGCAAGAAGAGCAGAGGAGCACTGGGCGTGAATCCCCGGACCA
CCTCGACCAGTGA
caggccagcagcagagggcggcggaggaagggttaggggttcattctcccgcttcctggc
ctcccttctcctttctaagccctgttctcctgtccctccatcccagacattgatggggac
atttcttccccagtgtcagctgtggggaacatggctggcctggtaagggggtccctgtgc

 2.03 PlyA -  39006  39001    6                              -0.45
 2.02 Term -  39084  39058   27  0  0  112   44    15 0.796  -2.43
 2.01 Intr -  39846  39718  129  0  0   77   56    94 0.805   5.99

Predicted peptide sequence(s):


>GPA33_1|GENSCAN_predicted_peptide_1|471_aa
MADKRQAQPTFLAALAMYVRVTVDAISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLI
QWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYE
CSVSLMSDLEGNTKSRVRLLVLDRHMQIYRLTAYIPSHGAGVAGFGEALAPDWFRFPSLP
ITAPPVNIQKPGCRKALLSVMHTWCDFGDTWDSSGGIGVLPALQLWNKAFASDSRHSWEK
AEWFGCVERDAPVPLKSSRDKAWLSKPILGVLWEVVFTFSCSPGTCLLAAVPPSKPECGI
EGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGY
YICTSSNEEGTQFCNITVAVRSPSMNVALYVGIAVGVVAALIIIGIIIYCCCCRGKDDNT
EDKEDARPNREAYEEPPEQLRELSREREEEDDYRQEEQRSTGRESPDHLDQ

>GPA33_1|GENSCAN_predicted_peptide_2|51_aa
PGAKAGEPSESFEGQREVKSNLGEGGRLCFRGSLKNMLVEPCTEAEECYGE