GENSCAN 1.0	Date run: 14-Jan-104	Time: 18:28:56

Sequence GLMN_1 : 54897 bp : 38.14% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1113   1263  151  2  1  102  131    68 0.909  10.94
cccctcccctgaagcagcctttcaggagcgcccgcgcgctgcggtctataactcgagatc
ggggcccagctttcagggtccaaaagtgggaagagatccttgctcctacctgcggctttt
cgagagcagcggggagccccggccttgcggccggcagaagacggcccagcgaagtccgcc
ATGGGGGAGAGTAGTCTGCCGGACGGGGACACGCTCCGGCGTCTCGCCCCGAGGCCCCGC
CTCCCTACGCGTAGCGCGGGGCGGGGCCAGAAGAGCGGGCTAAGACGCCGGAGGAGGTGG
CGGCGGCTGGGAGAGGCGAGGGTTCTGGCCG
gtaagtggagttgtggagaggttcagggtggccagggctcgcggttggccgtgagccgcg
gcggacttggtgctgcgggccgactaggccacgcgaggtggtggagcctgcccacctagg
cgagcaggaatcggaagacatggcttcctctgatgcagcccgcacgcgcgctggggtgtt

 1.02 Term +  11001  11278  278  1  2   43   42   206 0.321   6.14
taaacataacctaaacagcatttcatggcaagatgctgtattattttatgcacaactaag
aagaaaaaaacactgccaattagactgtgatgtgtcatcttgattcaagagttgttaaaa
tgtgggaggaggaagtgtcttataattccacatttgccgaatttcttgtcccatgtttag
CATACTTGATGAGCGACAACTTGATCTCTGTTTTAGTGATTCAGAAACTTCATAACAAGG
CATATTCAATTGGATTAGCATTGTCTACCCTTTGGAATCAGCTATCTCTTCTTCCTGTTC
CATACTCAAAAGAACAAATACAAATGGATGACTATGGCCTTTGTCAGTGTTGCAAGGCCT
TAATAGAGTTCACTAAGCCTTTTGTGGAAGAAGTCATTGATAACAAAGAAAACTCACTGG
AAAATGAAAAGTTAAAGGATGAATTACTGAAATTGTAA
gtataattttaagaacatctcacagtggacttaagtaattgatagttcagttattttatg
tttcttcactttgtttgacatgtaaatagaaatctagtttcagattttgaattttagaag
aatgtggggttcagttgatacagcatgggaacttgagacatttatattttaaaaaattat

 2.03 PlyA -  13858  13853    6                               1.05
 2.02 Term -  16083  15560  524  1  2   82   32   145 0.370   1.75
 2.01 Init -  19392  18966  427  0  1   81   77   287 0.163  23.41
 2.00 Prom -  23686  23647   40                              -9.15

 3.01 Init +  28572  28723  152  2  2   70  116    67 0.561   7.26
ttgaaagcaagtctcataggtcccactcacgctcaaagggagtgattacacctccccttg
gtgagaatgtggagtttgaatacacggggtggggggcattttagagtctgtgtgctatgg
tttccttttttatccatttcatagggttttttatcagcaattggacaccctttccccaaa
ATGATTTTTAATCATGGAAGGAAAAAGAGAACTTGGAATTACCTTGAATTTGAAGAAGAA
GAAAATAAACAGTTAGCAGACTCAATGGCTTCTCTGGCATATCTAGTATTTGTACAGGGC
ATCCATATTGATCAGCTTCCAATGGTCTTAAG
gtaagagttagtgtttggtttattcatgtattctaaaaggaatttcataaaattctcatt
tatctaatgtccaatatatgcatattaacacactaatacattttaaataaatagtaaagg
ctatttttaataagaatgatcccagctataatctgttaaagatagcagtagacaagtaat

 3.02 Intr +  35550  35634   85  0  1   72  116    -6 0.245  -0.50
gagcaataactattacaggtgactttgtaattggttgatgaccttgctaattaccattac
tgtggggtttttattcctagaagtaacacatggcctctttgaatttgtaaaacttttatc
accatttaattctaatgctgtccaggataatttcacatctattgtaattttgctttcaag
GTGCTTATTGAATACAAGTAATCACTCAGGTGTGGAGGCTTTTATTATTCAAAATATCAA
AAATCAAATTGACATGTCATTAAAG
gtaagaacatagccaaagtgtcaattaccaatttatttcgtagggtatatttattcatat
gtagaatacattaatgtgagttattgctctatctctagtattactattacttaaatatta
ttaaggcatattttttcccctatttctactatgttttaaaaactctgaatttggaaattt

 3.03 Intr +  36456  36565  110  2  2  110   66    28 0.155   0.96
gtgttctcaaactggcagggttcgttcctggtgtctggaaagtgaatgaaagtacggaaa
ttaaagttaaaaactgtattttaaatgtgcaattcttcatttttgtagtgtcaaggtatt
agaaaaacacatgaattacatgaattataaagctttctcaatttttcgtttgcttttcag
AGAACACGTAACAACAAATGGTTTACAGGACCACAGTTGATTTCCCTTCTTGATTTGGTA
CTTTTTCTCCCAGAGGGTGCAGAAACAGATTTACTGCAAAACTCAGATAG
gtgaggtgaccattaccaaagttcacatagtaaattcagaataaaatgtgaaacatctgc
ttagggaacctaaagtaataaaatgtcttttcctgtgattttatgatctatggctaattc
attaagttacataaagatttttcatatttaagtgatttgataatgtgtagaaacaaaatt

 3.04 Intr +  37262  37325   64  2  1   80  108     2 0.013  -0.80
attgtatgatttaaacaaatggaaaacagtgataagttattactactcaaaaagatatta
atggaaatagtttctattggcaaacctaattataaaaatatgaccaaagttttagcttat
tgagattgctgttgactatataaaaccatactgtaagtaacatatatttttaattaacag
GATTATGGCTTCATTAAATTTATTGAGGTATTTGGTTATCAAAGATAATGAAAATGACAA
TCAA
gtaagtgaagtatttgaaaagaaactgtgagtatattcaaaaggcataaggaatgtttca
gatattcagtacctaaagccaatatttaatatcttacccagatataaaggccgggaagag
tgccaacaattattctgaaacctgaagttaattcccaggagcatttaccaccccacatcc

 3.05 Intr +  46506  46676  171  2  0   54    5   142 0.002   1.72
agaagaggtgttcgtgtgcttggaattttcagcccttttccgctgctttttcctcgtctt
cgtggatttctacctttggtctttgctgttggtgacctttgggtggagtttttgcttggg
tcatcctttttgttgacgttaatgctattgctttgtgtttgttagttttccttctaacag
TCAGGCCCCTCTTCTGCAGGTCTGCTGCAGTTTGCTGGGGGTCCACTCCAGACCCTGTTT
GCCCGGGTATCACCATTGGAGGCTGCAGAACAGCAAAGATTGCTGCCTGCTCCTTCCTCT
GGAAGCTTCATCCCAGAGGGGCACCCGCCAGATGCCAGCCGGAGCTCTCCT
gtatgaggtggctgttgacccctgctgggaggtgtctccctatcaggaagcacgaggggt
cagggacccatttgaggaagcagtctgtcccttagcagagctcaagcgctgtgctgagag
atctgctgctctcttcagagctggcaggcaggaatgtttgtctgctgaagctgcacccac

 3.06 Intr +  52199  52310  112  1  1  105   81    23 0.147   2.33
atttttcttttaattggtattcacataactagctatagtaataattattaaatagtgaag
tccattgtgaaaagcaagggccatgtttcatttatttttgttttttgagcttttatcgcg
tttaatagtaggcaatcaatcattgttgaactaaataactcattctttcattcttaacag
ACTGGATTATGGACAGAACTTGGAAATATTGAGAATAATTTCTTAAAGCCACTTCATATA
GGACTTAATATGTCAAAAGCACATTATGAAGCAGAAATTAAAAATAGCCAAG
gttggtaatgtgcaattttgttttcaattaggtctaaaaagtagtctaattttggaactg
tcatattcaaatttaagaactttttaaaaatcttgtactttagagaccataacagctaag
ccattttatttatagttaaaattcttagcagatctataagctaatttacctaaaatcggg

 3.07 Intr +  53044  53126   83  2  2  100   53    54 0.166   1.54
gaattttgatatttcattctgtttgcttatagcttaagtataccctgagctgttaaacaa
tggacttaataatttatacaaataactgacatgttttaagttagtgaatgaaagtagctt
atacctttgttattgaaatctgagagttaagtgtcacacatgatttttcttctcttacag
AGGCCCAGAAATCTAAAGATCTTTGTTCTATAACTGTAAGTGGAGAAGAGATCCCTAATA
TGCCTCCTGAAATGCAGCTTAAG
gtgatctgaaattttcttttctttcctttttcttctttagaaacggggtcttgctatctt
gcccaagctggagtgcagtggcatgattgtggctcactgcagcttcaactccctgggctc
aagtgatccacccacctcagattcctgattagccaggactgcaggtgcacaccaccatgc

 3.08 Term +  53542  53658  117  0  0  107   48    94 0.227   4.86
actcctggcctctagtaatcctctcagctcagcctcccaaagcacaggaattacaggtgc
aaaccactgtacctggtcttaaatattcctaagctacctccagctgaaatcttttctgtg
ttttgctttgttttgctttaaaggcagcattaataacattactttttcttggcattgcag
GTCCTGCATTCAGCTCTTTTCACATTTGATTTGATTGAAAGTGTTCTAGCTCGAGTGGAA
GAACTCATTGAAATAAAAACAAAGTCTACCTCTGAAGAAAATATTGGGATAAAGTGA
aagttccatttcctaaataaaaactaataaaatatagtactttccattatgattcattta
atacctttataaaaaatttttctgtaaaaatttactgcttgaaaaataaatgtagctttt
ctcatttatcaatttctataatgatacactatagaacaggtttttttggttttaaagtta

Predicted peptide sequence(s):


>GLMN_1|GENSCAN_predicted_peptide_1|142_aa
MGESSLPDGDTLRRLAPRPRLPTRSAGRGQKSGLRRRRRWRRLGEARVLAAYLMSDNLIS
VLVIQKLHNKAYSIGLALSTLWNQLSLLPVPYSKEQIQMDDYGLCQCCKALIEFTKPFVE
EVIDNKENSLENEKLKDELLKL

>GLMN_1|GENSCAN_predicted_peptide_2|316_aa
MARELHDACTSFNSRFDQVEERVSVTEDPINEIKQEDKIREKRVQRNEQSLQEIWDYVKR
PNLCLIGAPESDRENGTKLENTLQDIIQENFHNLARQANIQIQEIQRTPQRYSLRRATPR
HIIVRFTKVEVKEKLLRAAREKELEKTILKLIWNQKRARIAKTILSQKNKAGGIKLPDFK
LYYKDTVTKTDWYWYRNRYTDQWNRTEASEITLHIYNHLIFDKPDKNKQWGKDSLFNKWC
WENWLAICRKLKLDPFLTPYAKINSRWIKDLNVRLNTIKTLKENLGNTIQDIGMGKDFMI
KTPKGMSTKAKIDKWD

>GLMN_1|GENSCAN_predicted_peptide_3|297_aa
MIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHIDQLPMVLRCLLNTSNHS
GVEAFIIQNIKNQIDMSLKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMAS
LNLLRYLVIKDNENDNQSGPSSAGLLQFAGGPLQTLFARVSPLEAAEQQRLLPAPSSGSF
IPEGHPPDASRSSPTGLWTELGNIENNFLKPLHIGLNMSKAHYEAEIKNSQEAQKSKDLC
SITVSGEEIPNMPPEMQLKVLHSALFTFDLIESVLARVEELIEIKTKSTSEENIGIK