GENSCAN 1.0	Date run: 14-Jan-104	Time: 18:59:12

Sequence FHL3_1 : 5063 bp : 56.51% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1223   1378  156  1  0  108   86   268 0.441  28.48
ctggtttcccagaagcaccccttccccatccccacctactctgaactggcatttcctatg
ccgggtctcttggctgtgttttgaatgcagaggcctctttgccaggagccaagccacagc
ctctctgtgtgaccccagttccaccttgtgctcctaacagggttctctccccttgccacc
ATGAGCGAGTCATTTGACTGTGCAAAATGCAACGAGTCCCTGTATGGACGCAAGTACATC
CAGACAGACAGCGGCCCCTACTGTGTGCCCTGCTATGACAATACCTTTGCCAACACCTGT
GCTGAGTGCCAGCAGCTTATCGGGCATGACTCGAGG
gtaaggagagggccaggccaggcaggaggtgggtggtgaccagtggaagggggcaaagga
tgggtccatgaggcctgggtgccagtgcccctgctgtgttccccacaggagctgttctat
gaagaccgccatttccacgagggctgcttccgctgctgccgctgccagcgctcactagcc

 1.02 Intr +   1487   1661  175  1  1  116   84   204 0.982  22.83
gtgccctgctatgacaatacctttgccaacacctgtgctgagtgccagcagcttatcggg
catgactcgagggtaaggagagggccaggccaggcaggaggtgggtggtgaccagtggaa
gggggcaaaggatgggtccatgaggcctgggtgccagtgcccctgctgtgttccccacag
GAGCTGTTCTATGAAGACCGCCATTTCCACGAGGGCTGCTTCCGCTGCTGCCGCTGCCAG
CGCTCACTAGCCGATGAACCCTTCACCTGCCAGGACAGTGAGCTGCTCTGCAATGACTGC
TACTGCAGTGCGTTTTCCTCGCAGTGCTCCGCTTGTGGGGAGACTGTCATGCCTG
gtatgtgttcaggggctcatcttgtgtgagaactggcatctgcgtagggtctttgcatgt
gtctgtctgatacatggagacttggtctgtgtaaagacctgcatacacagcatgtttctg
gaaatttagtatatacgggatctgtttgcctggtatactcctgggggctactatgtacag

 1.03 Intr +   2503   2672  170  2  2  113   81   152 0.999  17.18
cggtgtctggggagaggttagcatgtgtaatatacatagggcgggggggttcttgctgca
tgtgcacggacaccaccctgctcacgctgagagaggagtggagactcctggggaagttac
agagggtggccctcaggagcatgggacacaacctctaaatgggacccctgttccccacag
GGTCCCGGAAGCTGGAATATGGAGGCCAGACATGGCATGAGCACTGCTTCCTGTGCAGTG
GCTGTGAACAGCCACTGGGCTCCCGTTCTTTTGTGCCCGACAAGGGTGCTCACTACTGCG
TGCCCTGCTATGAGAACAAGTTTGCTCCTCGCTGCGCCCGCTGCAGCAAG
gtgggggctgggccagccaggtgggggtgagtgaggcctgttgtggggtgggaatcccca
ctcatacctactaatggatgctgcccccacagacgctgacacagggtggagtgacatacc
gtgatcagccgtggcatcgagaatgtctggtctgtaccggatgccagacgcccctggcag

 1.04 Intr +   2765   2951  187  1  1   64   47   194 0.188  12.68
ccgttcttttgtgcccgacaagggtgctcactactgcgtgccctgctatgagaacaagtt
tgctcctcgctgcgcccgctgcagcaaggtgggggctgggccagccaggtgggggtgagt
gaggcctgttgtggggtgggaatccccactcatacctactaatggatgctgcccccacag
ACGCTGACACAGGGTGGAGTGACATACCGTGATCAGCCGTGGCATCGAGAATGTCTGGTC
TGTACCGGATGCCAGACGCCCCTGGCAGGGCAGCAGTTCACCTCCCGGGATGAAGATCCC
TACTGTGTGGCCTGTTTTGGAGAACTCTTTGCACCTAAGTGCAGCAGCTGCAAGCGCCCC
ATCGTAG
gtgggacaagggtcaaagaacggagtgggtagggtgcaggcaagggagtgggatgtggta
ttgggtgaggttgagggccggaccatccccacatctgcatagctaacttccagcctccct
ccaggactcggtggaggcaagtatgtgtcctttgaagaccgacactggcaccacaactgc

Predicted peptide sequence(s):


>FHL3_1|GENSCAN_predicted_peptide_1|230_aa
MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRH
FHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQ
TWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQP
WHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVX