GENSCAN 1.0	Date run: 14-Jan-104	Time: 15:23:03

Sequence FAM20B_1 : 53066 bp : 43.29% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init -   1380   1168  213  0  0   75   14   249 0.318  12.94
 1.00 Prom -   5922   5883   40                              -5.46

 2.01 Init +  19153  19529  377  0  2  100  115   369 0.997  35.21
aaggacagaatttttgatcaaattttgctttgtacttgggcttgcaggaactgtggaagg
tgcatcagtgaagaaatggaccaatgtgtataatcatggaatctccttgctaaccatcac
caccagctctccttaatacatgagcaagagtgggtcaggggagaaggaaaagaggtcaac
ATGAAGCTAAAGCAGCGAGTCGTGCTGTTAGCAATTCTCCTTGTCATTTTTATCTTCACC
AAAGTTTTCCTGATTGACAACTTAGATACATCAGCTGCCAACCGGGAGGACCAGAGGGCC
TTTCACCGAATGATGACTGGCTTGCGGGTGGAGCTGGCACCCAAGCTGGACCATACCTTG
CAGTCTCCCTGGGAGATTGCAGCCCAGTGGGTGGTTCCCCGGGAAGTGTACCCTGAAGAG
ACACCAGAGCTGGGGGCAGTCATGCATGCCATGGCCACCAAGAAAATCATTAAAGCTGAT
GTGGGTTATAAAGGGACACAGCTGAAAGCCTTACTGATACTTGAAGGAGGCCAGAAAGTT
GTTTTCAAACCTAAGCG
gtaagttttgatcttggaagctgcatgtgctagttggttgattcatttaacttgggattt
atataagatttattttgtcatcttctcttggaagtctcttcagtaaaataagaggggtag
actagatctctaaagtcttttctagcacttaacatgaatctacctttatagtatcatata

 2.02 Intr +  25584  25670   87  0  0   82   96    61 0.974   5.39
ctacctcatcttcattccatctaccggcaattcatgctaatccacagttgtttgcagggt
tgacagagaaggtgactatagcagaatcaggcttgctaatgggtgtattctaccacttgt
gctgtcacctgttactggtgtaatccacgtatacatctgtgcttcccattcactttgcag
GTATAGCCGAGACCATGTGGTGGAAGGGGAACCGTATGCTGGTTATGATAGACACAATGC
AGAGGTAGCAGCCTTTCACTTGGACAG
gtgcgtatgatcacagcagcttatgttcattttgtttgctttcaaaaatctttcttggag
aggactcgtggactccttcagaaggatgcaacactaataaataacttgttatcgatttta
gatagctaattgactagttccattaaacttgtatgagtctcataatttggttggcaccag

 2.03 Intr +  29834  29943  110  2  2   65   82    57 0.989   2.73
aataaattatacacaccttcacattaaattcctaaatatatgtacctctaaaaaattagg
tttagctactagctaaaaaccctttacacatttgacatgatgaactgtaatttttaagac
tgttacttaaaaaacatcccctaagatttttctcttctgttcttcaatcttccaaaccag
GATTCTGGGTTTCCACCGAGCCCCCTTGGTAGTTGGCAGATTTGTTAATCTTCGGACAGA
GATCAAACCTGTCGCCACAGAGCAGCTGTTGAGCACCTTCCTAACTGTAG
gtaagaagattgtagaggacatttatataggggaatgattaataagttaaaatggggcat
tgttgagcaagctggctcatgacttttaggaattgaagaactcagtggaatacaaaagca
aatcagacaaccagctctcaggttatttgggaaaatgaatctaaaggagatggcaggaaa

 2.04 Intr +  33028  33135  108  2  0   87   23    83 0.400   1.96
gtgttacccacattttatacctaagagtggaggcttagaagtgtctaatgactttcccaa
agtcacaaaactactaattgttagccaggatccaaactcagattttaagactctaaaatc
tttcattagcttatagtctttatttattcagtacgactttatttcacttctgtttgacag
GTACTGAGCTAGGTGCTGAATATGCAAAACTGAATGACCTTCTTATCTTCAAGGATCTTT
GTCTAGTGCGGGAGCCAGACATGTACAAAGGGGCTATGGACTGTTGGG
gtgggggtgggaatagggaggtggccaagaagttatggccaggtgataattcgtgaaggt
gatattttaaccaagtcttaaagggaaaatagcagtctcttaggtagatacagtgggaaa
gaatattttaggtttgtatttaacattttttgtgctatagatacctttggcagtctggaa

 2.05 Intr +  39232  39403  172  2  1  100   99    53 0.994   6.60
tttacaccgtgtgcttttttattacctatacaggaaaataaatgtttgaaatatagtaaa
ctcagggtctttgttttcaccatgcttatttacttagctactctgttctgcattatttgg
gagagaacttggagtcttcgttatttccttaagtgtatttggctcctttctgtcctttag
GAAACAATACTTGTTTTTATGGGAAGTGCTATTACTGCCGAGAAACAGAACCAGCTTGTG
CTGATGGAGACATAATGGAGGGATCTGTCACACTTTGGCTTCCAGATGTGTGGCCTCTGC
AGAAGCACCGTCACCCATGGGGCAGGACTTACCGAGAAGGCAAATTGGCCAG
gtaaatgctcctatgagccattacttaattctcccctgtgcctagccaggtgccaactct
gtaaaggagccagcagttctgtccaagagtgaaaagaactgtggagtcaggggcaaaccg
gtaggtaggaactctgtcttctctttgtgtgtaacagtgccaggtacagtgttgtcactc

 2.06 Intr +  39610  39801  192  1  0  120  100   313 0.986  34.31
aattctcccctgtgcctagccaggtgccaactctgtaaaggagccagcagttctgtccaa
gagtgaaaagaactgtggagtcaggggcaaaccggtaggtaggaactctgtcttctcttt
gtgtgtaacagtgccaggtacagtgttgtcactcagtgctgtgatgctgcttgtctccag
GTGGGAGTATGATGAGAGCTACTGTGATGCTGTGAAGAAAACGTCCCCTTATGACTCTGG
CCCGCGCCTCTTGGACATCATTGACACAGCTGTCTTTGATTACCTGATTGGCAATGCTGA
CCGCCATCACTATGAGAGCTTTCAAGATGATGAAGGCGCTAGTATGCTCATCCTTCTTGA
TAATGCCAAAAG
gtgagaccagcaggactgtccttgtcagggaggggtttctgtatatgaaagaagggcatt
ttccagagcatcctggagaatatccagaatgcaattgataggcaacatccttcttttttc
cacttggagtctttgctattggtacctgtccttctctccactctcagggatctcagtact

 2.07 Term +  47218  47449  232  1  1   59   31   247 0.391  12.05
aacaatatcaaaacatagtaatgtggcttactcattatgtaggggtaattctaaagcaaa
aattatttagttaaaggattttacctaattattttttcacttttgtctgcctagcaggct
ttcaactccgtttgataatgagaagttttatgtaccttgttctataactttttctcccag
CATTCGGGTGTCCACCTGGAACAGACTGAACTACCTAAAGAATGGTGTGCTAAAGTCTGC
CTTAAAATCTGCCATGGCCCATGACCCCATCTCCCCAGTGCTCTCTGATCCTCATCTGGA
CGCCGTGGACCAGCGGCTCCTGAGTGTCCTGGCCACCGTGAAGCAGTGCACCGACCAGTT
TGGGATGGACACAGTACTGGTGGAAGACAGGATGCCTCTCTCACACTTGTAA
ttctcgacacaaaataagtgaaacttctttttacaaagatagagaaacagcacaatcaat
tccaaatggtatgagatggattggaagtggccagcagcaagttctggtgacgggacagag
tggccttggatgtctttggtattttctgtagtagaaactaaagcaaagaccacaagtttc

Predicted peptide sequence(s):


>FAM20B_1|GENSCAN_predicted_peptide_1|71_aa
MAARAVRCGAAPAAPAASGEGQPHAALTAPSRRRRHSGSGPPPARPFPGHLSPRRAAVPH
PPPRLRGPRLL

>FAM20B_1|GENSCAN_predicted_peptide_2|425_aa
MKLKQRVVLLAILLVIFIFTKVFLIDNLDTSAANREDQRAFHRMMTGLRVELAPKLDHTL
QSPWEIAAQWVVPREVYPEETPELGAVMHAMATKKIIKADVGYKGTQLKALLILEGGQKV
VFKPKRYSRDHVVEGEPYAGYDRHNAEVAAFHLDRILGFHRAPLVVGRFVNLRTEIKPVA
TEQLLSTFLTVGTELGAEYAKLNDLLIFKDLCLVREPDMYKGAMDCWGNNTCFYGKCYYC
RETEPACADGDIMEGSVTLWLPDVWPLQKHRHPWGRTYREGKLARWEYDESYCDAVKKTS
PYDSGPRLLDIIDTAVFDYLIGNADRHHYESFQDDEGASMLILLDNAKSIRVSTWNRLNY
LKNGVLKSALKSAMAHDPISPVLSDPHLDAVDQRLLSVLATVKQCTDQFGMDTVLVEDRM
PLSHL