GENSCAN 1.0	Date run: 14-Jan-104	Time: 20:33:37

Sequence EFNA3_1 : 11038 bp : 60.69% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1271   1398  128  1  2   83   73   377 0.998  33.45
gggcctgtcgggggcgcgccaggggcggggcttcgggggcgcgcccaggagggcggaggg
aagggctgggggcgtggcctaaggctgggggccgacggcggcggcagcagggagctggga
agcggagaagccgggagcgcggggctcagtcggggggcggcggcggcggcggctccgggg
ATGGCGGCGGCTCCGCTGCTGCTGCTGCTGCTGCTCGTGCCCGTGCCGCTGCTGCCGCTG
CTGGCCCAAGGGCCCGGAGGGGCGCTGGGAAACCGGCATGCGGTGTACTGGAACAGCTCC
AACCAGCA
gtgagtcggggaccctgggagtccgcgcgtcccgtctcagtgagagggggagccggtggg
cccgagaagtcctgggggatcccggggtgggagtcctgggagaccagagctgggggctgg
gaggggacggagagggggacgcactctgtgggcgtctaggaaactcgggggtgtctgaag

 1.02 Intr +   2884   2911   28  1  1   82   94    11 0.528   0.35
ggggatgagccaacgacgcccccctctcgcttcccatggaaacctcgggggtggggacgt
ggcccctcccccccggagcgggactccaagaactccggggggcgctgggggctgactttc
cagctctatctagctcagccccctcccccagactcacacgtccgccccccaccccgctag
AGTCTGGCGGGGAACGGAGAGCTCGCAG
gtgaggggccccgggttccccgccacccttggagcacctcagcgttcttaggggaagcca
gagccggggaggatgcgggaataggtttggtggggggaggtgttgatcaggttcccctcc
cccgcatacacctgggcgcaggtgaaagctcagggagcgggtgggggagcccgggttccg

 1.03 Term +   4219   4410  192  0  0  118   55   103 0.952   8.39
gtctctcctgttctccaagactctcggttctcgttctcttccctgcctctctcggtttct
gcgtctctctcgcactgtgtctcccttcctttcccctttcagtgaatccggcctctgcca
ccctccccttgtcggtgtgtgtctccccctcactccgtctctgtgtctcgctttcggcag
GTCTCTCGCTCCTCTCCGCCGCTGCAGATCAATAAACCTTCGCCGCCGCCGCCGCCGCTG
TCGCAGGGAGGAGGGGCGGAGGTGTCGGGCGCGCTGATTCTCCCCCACCCGACGCGGCCC
AGGGAAGCCTTGCGCCCAGACCTGGGCTGTCCAGACTGGGACGGGCGGGGCGCCGAGGCC
CAGGGCGCCTGA
ggggcgcagaggtgtcagcgtgcaaccgccgccccccagcgttcccgccaccaccgccac
caccctcaaagcccgggcgcgcggaccccacgccgcgcacacgtggtccggcctcgcctg
ctggagcgggcggcgcgcagcctcgggggcgcgcgctagagggaagaggaacccgggtct

 2.01 Init +   7036   7106   71  0  2   62   56    91 0.977   1.99
tacatgcgtctgtaagggcaggtcctgttggactggcctccggggtggactggcagccgc
agggaagcatggtgggagaagcgatggagggtgtgtgcgtccctcggaggggatccctcc
cacgttcacccttggcttccatccctcccatccctcctcccggctgctgaattatggggg
ATGGACGGAGGAAATCCGGGCCTGGGTCTGAGAGTCGCTGGGGCCTGCGCCGTTTCTGTG
GCAACCAAAGC
gtacgttcccttcttccctccgcccctctccctcgcctccttttctttggaggcaggccg
ggcttccctgcgcctttgctaccctctggtggccaacaggagaaggacagaccaagaagg
agggcacggaaggagacttaggggagcggcggcactagggccccgggggcagagacaggg

 2.02 Intr +   7420   7733  314  1  2  129   65   677 0.985  66.60
agacttaggggagcggcggcactagggccccgggggcagagacagggctgagccgcgagg
aagctcggaggaaaagtcggaaggctacgcggaccctggggaggggctgcggagcggtca
gatggaaagcggctttgctctggggtttcttctctctgagccgcttcctcttccccacag
CCTGCGGCGAGAGGGCTACACCGTGCAGGTGAACGTGAACGACTATCTGGATATTTACTG
CCCGCACTACAACAGCTCGGGGGTGGGCCCCGGGGCGGGACCGGGGCCCGGAGGCGGGGC
AGAGCAGTACGTGCTGTACATGGTGAGCCGCAACGGCTACCGCACCTGCAACGCCAGCCA
GGGCTTCAAGCGCTGGGAGTGCAACCGGCCGCACGCCCCGCACAGCCCCATCAAGTTCTC
GGAGAAGTTCCAGCGCTACAGCGCCTTCTCTCTGGGCTACGAGTTCCACGCCGGCCACGA
GTACTACTACATCT
gtgagtgacggcggccgggcgggcgggtctgaacgcgagagtctgagtgacagccggggg
gtggagcccctaggctccggggcggggccggcgcggcgggcgccaggtctcgcggctgag
accagggaggaggcgtgggcacgggacgcctgaggggttcagctcagacgaggtcgtggg

 2.03 Intr +   8206   8271   66  2  0   74   81    68 0.963   4.72
gaccaaaggggcgtctagggccgacggcagagctaaagtgacccgtgtccaaagggtagg
ggagctcctgaaggagaccgcccgacggggacagtttggagggggtgagaaatagagccg
tcgagggagggcacaggcacacattgggcgaaagtgactcaggcccggtctcctccccag
CCACGCCCACTCACAACCTGCACTGGAAGTGTCTGAGGATGAAGGTGTTCGTCTGCTGCG
CCTCCA
gtgagtagaataggctccgagccgcgcccccatcctcagctccctgctttggggctcccc
tggcttcctgggggtgggggcggagggcacaggtgaggggggcttgctccccagccgtag
caaggggagggaatcctggccctgactctcccctcctctctccccacccgcaccccaccc

 2.04 Intr +   8457   8534   78  1  0   83   92   126 0.938  13.18
tagaataggctccgagccgcgcccccatcctcagctccctgctttggggctcccctggct
tcctgggggtgggggcggagggcacaggtgaggggggcttgctccccagccgtagcaagg
ggagggaatcctggccctgactctcccctcctctctccccacccgcaccccaccccgcag
CATCGCACTCCGGGGAGAAGCCGGTCCCCACTCTCCCCCAGTTCACCATGGGCCCCAATG
TGAAGATCAACGTGCTGG
gtgagtctgcgcagcgccctctggtggccactgctggaaccgcagccccccgccccggtg
cctgctcacctcgcatgccttccctgggggcactgatacttcctaccctgtgggtggtca
cgtccctggctccattgctgctgccgcgtgcccctgccctggcgcgcaacccagccctca

 2.05 Term +   8742   8872  131  1  2  128   36   233 0.926  21.38
ccactgctggaaccgcagccccccgccccggtgcctgctcacctcgcatgccttccctgg
gggcactgatacttcctaccctgtgggtggtcacgtccctggctccattgctgctgccgc
gtgcccctgccctggcgcgcaacccagccctcaccagtctgtctgttcctctgtccacag
AAGACTTTGAGGGAGAGAACCCTCAGGTGCCCAAGCTTGAGAAGAGCATCAGCGGGACCA
GCCCCAAACGGGAACACCTGCCCCTGGCCGTGGGCATCGCCTTCTTCCTCATGACGTTCT
TGGCCTCCTAG
ctctgccccctcccctggggggggagagatggggcggggcttggaaggagcagggagcct
ttggcctctccaagggaagcctagtgggcctagacccctcctcccatggctagaagtggg
gcctgcaccatacatctgtgtccgccccctctaccccttccccccacgtagggcactgta

Predicted peptide sequence(s):


>EFNA3_1|GENSCAN_predicted_peptide_1|115_aa
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQQVWRGTESSQVSRSSPPL
QINKPSPPPPPLSQGGGAEVSGALILPHPTRPREALRPDLGCPDWDGRGAEAQGA

>EFNA3_1|GENSCAN_predicted_peptide_2|219_aa
MDGGNPGLGLRVAGACAVSVATKALRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGP
GGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFH
AGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFE
GENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS