GENSCAN 1.0	Date run: 14-Jan-104	Time: 19:32:00

Sequence DIO1_1 : 19280 bp : 47.63% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1207   1543  337  0  1  104   77   290 0.451  25.64
gtgcacctggttaggaattttctatctcatgacagaaaggcaaacatcttctgacctgac
tccttcccctgacccggggttggctgctcctaccctgcaccttcattcagctccgcccag
tgttgcctggctgcagcctctctgcccatagaactcagagcttactctggctttgccgag
ATGGGGCTGCCCCAGCCAGGGCTGTGGCTGAAGAGGCTCTGGGTGCTCTTGGAGGTGGCT
GTGCATGTGGTCGTGGGTAAAGTGCTTCTGATATTGTTTCCAGACAGAGTCAAGCGGAAC
ATCCTGGCCATGGGCGAGAAGACGGGTATGACCAGGAACCCCCATTTCAGCCACGACAAC
TGGATACCAACCTTTTTCAGCACCCAGTATTTCTGGTTCGTCTTGAAGGTCCGTTGGCAG
CGACTAGAGGACACGACTGAGCTAGGGGGTCTGGCCCCAAACTGCCCGGTGGTCCGCCTC
TCAGGACAGAGGTGCAACATTTGGGAGTTTATGCAAG
gtcaggaggctgccacacacttgaggggtgcttgaaatagcagtggtagagggggatgaa
gagatgggttggaaagtcctgaattctcctactacttttgctgctccttttggaccttct
tgtcctcttcctgcttcctgaaactagaacttcttgtggattgtttctctaagtaacatc

 1.02 Intr +  13091  13290  200  0  2   92   36   203 0.479  14.57
cagttctggatcaatcactaattcctgacgtgaccttgcacattcaaccataatgggaaa
ccaggccaaatcattgccaagggctcctctgagaacctcagttaaaagtgaggggctatt
tagtctgcaggaagtgtgtgctgtgtcaatgggactcggtgcctggcctttctcttgtag
ATGGCTGGGCTTTTAAGAACAACATGGACATCAGAAATCACCAGAACCTTCAGGATCGCC
TGCAGGCAGCCCATCTACTGCTGGCCAGGAGCCCCCAGTGCCCTGTGGTGGTGGACACCA
TGCAGAACCAGAGCAGCCAGCTCTACGCAGCACTGCCTGAGAGGCTCTACATAATCCAGG
AGGGCAGGATCCTCTACAAG
gtggtgacctggggacagggggcccagggagggcaaaggggcccagggagggcaagggca
aagagaaggctttgcatcaagcagaactggattcaaatcaccacccagccacttaccagc
catgtgaccatgggcgagtgctttcacttcttggagttccttcaatttcctcttctgcaa

 1.03 Term +  16927  16995   69  0  0   98   33    66 0.246   0.04
tgccactgtacacactttctcaaccacctcacggttgcatctgccattgaattagccatg
ctgatggctcctacacagacatcatttgaccacctcttgcaactaacctccagacctaca
tgttccttacaacttggaaatccttacaagttgggaatgcctgattcgtttctcttgcag
GGTAAATCTGGCCCTTGGAACTACAACCCAGAGGAAGTTCGTGCTGTTCTGGAAAAGCTC
CACAGTTAA
tctggacagatacctcaattctaggtgaccaacgggagggcttctcaaggcttagctctc
cctgagacccagctggcttttacccttgacctgtgtccctagctgaatcactagctcaga
tttttctgatctaagcaaacaactcccagctgaggaatgcaggccacagcacccaatcaa

Predicted peptide sequence(s):


>DIO1_1|GENSCAN_predicted_peptide_1|201_aa
MGLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGMTRNPHFSHDN
WIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQDGWAFKNN
MDIRNHQNLQDRLQAAHLLLARSPQCPVVVDTMQNQSSQLYAALPERLYIIQEGRILYKG
KSGPWNYNPEEVRAVLEKLHS