GENSCAN 1.0	Date run: 14-Jan-104	Time: 18:22:26

Sequence CTBS_1 : 22276 bp : 38.25% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    795    928  134  2  2   61   66    81 0.554   2.86
tctttgtccttgtgtttaggttgttaaacttgatttttaacaggagagtaggcaaaatta
gatgcttgaattcaaaccacgatcttaactaagacctgatatccgtaagtaaaaattttt
ggtattccagctttcttttgagtagcaaaagaaaaacaaagtcttttggccactccaacc
ATGTTACTCAGTAGGCCCTTCCAAAGACACCCACTTCTCCATTTTGGGGATCCCCTTGTA
CCTTCAGACTCCACAAGGAGTACACGACCAGCCACGACAAAACGAGATGCAGACTATTGG
GAGGACTATAAACG
gtaggggtgatacccatttgagtccacgaacggccctctcggcgccgcagacactggctg
tcccccgagacgctccagcagccacttaacttcacccacctgtagcgcccggggacgctc
gaagcccgacctcccacgcccgccccggagccccgcccctcccgcccctccccgcccttc

 1.02 Intr +   1242   1377  136  0  1   76   60   285 0.484  24.15
ccacgcccgccccggagccccgcccctcccgcccctccccgcccttcccgactctccccg
ccccttcctgccccgacgcgcagcaggccccgcccacccaggcggtaggaacccactccg
gcccgctagacctgctgctatgtcccggccgcagcttcgacgctggcgcctcgtctctag
CCCGCCGAGCGGCGTCCCGGGTCTAGCGCTGCTGGCGCTGCTGGCGCTGCTGGCGCTGCG
GCTCGCGGCCGGGACCGACTGCCCATGCCCGGAGCCTGAGCTCTGCCGCCCGATTCGCCA
CCATCCAGATTTCGAG
gtcagcgccttcctctgctcctctaggtctgggcttcagggcacgaagagaagttagggt
agaacggagccctaaggagaggtgccgtgggcgccgaaaccagctttgaccactcgatga
gggccttcctgtttacggatccttcaatttatagatgaggaagctcgggctcagagaagt

 1.03 Intr +   4896   5034  139  2  1   94   95   134 0.999  13.82
ctttcccagcctggctaattacccctgccaccaattatcttgggacccctatgtcttatg
cacttgtactctcactgccaccatagtgtttggtgtatggtgatgtttgatgaacggtat
tttggacggtcagcataatattcttggtttaaatgatggtgctcatctttgttctggcag
GTCTTTGTGTTTGATGTTGGACAGAAAACTTGGAAATCTTATGATTGGTCACAGATTACA
ACTGTGGCAACATTTGGAAAATATGACTCAGAACTTATGTGCTACGCTCATTCAAAAGGA
GCCAGAGTAGTACTTAAAG
gtatgttgtttccagatctatgtgtgcagcaattgggaaatttatctgtatcacttgcta
tagtcccgactttccaaaaaagtccttttatgtttatctgtttttgttaggatcctataa
ttaatcttagatactgtgtaattcatttcacaaacacagatctttttaaaagaattaaac

 1.04 Intr +   5477   5685  209  0  2   65   98   121 0.999   8.67
taacttcagaacaattttactaatgatttataatggttattttggagattcatgagtaat
ggctttctgttactttggtatattctttctccattggaaaacttcagttaagggcttagt
cttccaaaataatgaaatgtttttgcatacatgttcaaaagatatatacttcttccacag
GAGATGTATCCTTAAAGGATATCATTGATCCTGCTTTCAGAGCATCCTGGATAGCTCAAA
AACTTAATTTGGCCAAAACACAATATATGGATGGAATTAATATAGATATAGAGCAAGAAG
TTAATTGTTTATCACCTGAATATGATGCATTAACTGCTTTAGTCAAAGAAACTACAGACT
CTTTCCATCGTGAAATTGAGGGATCACAG
gtaaaaactcatttattttttggaaacctcatattttccatatcagaatatactcatgag
ggtataactaatataatctttgttttatagtaatgcaatgggaaagagtttcagcactta
tttcctaaaaaatttttctggagcctttggtgttcttatttaaggaattttaaagcccta

 1.05 Intr +   9604   9775  172  0  1   61   99   113 0.694   8.29
agcaaaaaatatttcttagaatggttcaagttctatgtgtgtcaaaccctacattcatat
actgtaagcagttccttttccttgtgtagtataaggtaaaaaatatatataattttaaaa
atctgacgtaatatgcacacgtgatcatattacataaaatagtaagatttttttccacag
GTAACCTTTGATGTAGCTTGGTCTCCAAAGAACATAGACAGAAGATGCTATAATTATACT
GGAATCGCAGATGCTTGTGACTTCCTCTTTGTGATGTCTTATGATGAACAAAGTCAGATC
TGGTCAGAATGTATTGCAGCAGCCAATGCTCCCTATAATCAGACATTAACTG
gtaagactctaaacatggtcatttattaataatattaataatattctataaattaaaata
ttaagatgtttttagtatttctaagttatatgtatacgtttttcaattgtaaggcttgct
tcaaacatgtaaaaatcacttaattgaaagctttaaagtttacaaaaagttttaaagttt

 1.06 Intr +  11784  11881   98  1  2   59   75    79 0.999   2.51
agaaagcaagatatagaatttatggttcttaagggatgttttataacatattaaacaata
ttagtgttttttataaatgtacttgtttttacaaacagattctgaacggttgcatagctt
gtatgaacacattgacatatgaagagaaacaaatatgctttttctctcctgcttgactag
GATATAATGACTACATCAAGATGAGCATTAATCCTAAGAAACTTGTAATGGGTGTTCCTT
GGTATGGTTATGATTATACCTGCCTGAATCTGTCTGAG
gtaggaacagtcatttgttacataatttttattatctattatattttttagagtctctct
gttttcattagaaatatataaactttagaatctctgaaatatagtttgagataaaaatta
tttatttttacttctatgaaagcttatgattatcatacattttcatttaataatgaaatt

 1.07 Intr +  12198  12371  174  2  0   93   88   116 0.643  11.31
tgaaagcttatgattatcatacattttcatttaataatgaaatttattttaacctttttt
ctgtatagtcaggttttctatggtatatgttttatttctaaataatttatatatttttgg
tttggcttttaagaattgcataattgataatatataacatgagcacttttgcatttctag
GATCATGTTTGTACCATTGCAAAAGTCCCTTTCCGGGGGGCTCCTTGTAGTGACGCTGCA
GGACGTCAGGTGCCCTACAAAACGATCATGAAGCAAATAAATAGTTCTATTTCTGGAAAC
CTATGGGATAAAGATCAGCGGGCTCCTTATTATAACTATAAAGTAAGACTTTTC
gtaagttatgagcatttattctattagtttttgtaattattttcataattagatgtttga
tatcaagaatttctatcagttttcttttagggcataacatgcagactgctatttacatga
gtaaacttgtctttgaatctgtaatcaggaactttagttccctggcgagcaattggagtt

Predicted peptide sequence(s):


>CTBS_1|GENSCAN_predicted_peptide_1|354_aa
MLLSRPFQRHPLLHFGDPLVPSDSTRSTRPATTKRDADYWEDYKRPPSGVPGLALLALLA
LLALRLAAGTDCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDS
ELMCYAHSKGARVVLKGDVSLKDIIDPAFRASWIAQKLNLAKTQYMDGINIDIEQEVNCL
SPEYDALTALVKETTDSFHREIEGSQVTFDVAWSPKNIDRRCYNYTGIADACDFLFVMSY
DEQSQIWSECIAAANAPYNQTLTGYNDYIKMSINPKKLVMGVPWYGYDYTCLNLSEDHVC
TIAKVPFRGAPCSDAAGRQVPYKTIMKQINSSISGNLWDKDQRAPYYNYKVRLF