GENSCAN 1.0	Date run: 14-Jan-104	Time: 20:43:06

Sequence CRABP2_1 : 8372 bp : 56.10% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1338   1407   70  2  1  114   82   125 0.564  15.66
ttccgtacagggtataaaagctgtccgcgcgggagcccaggccagctttggggttgtccc
tggacttgtcttggttccagaacctgacgacccggcgacggcgacgtctcttttgactaa
aagacagtgtccagtgctccagcctaggagtctacggggaccgcctcccgcgccgccacc
ATGCCCAACTTCTCTGGCAACTGGAAAATCATCCGATCGGAAAACTTCGAGGAATTGCTC
AAAGTGCTGG
gtaaggaaatgttcgagggcccaggtggggcaagggggggctctggagtcctcgaagttg
gggatgagaaagacagcgggaccacaatcagggcgtgagacactgggtgcctgcatcccc
gaaaaacgtgccaggcgtccgggtcccggggctctgggcacgacgcctaaatcccgcttt

 1.02 Intr +   5732   5910  179  0  2  125  113   185 0.997  24.86
caccgcctaccgtctccttcaaggcactttcttagacacccaggcaccaggcagatgcac
cccccaacacacccaccccaagcaagtcacaaatcagcctgctccaactgtcttatgggg
agggtgtgagagaggtgcccaaaggcccctaaaaggtgagcctctcctctctccccacag
GGGTGAATGTGATGCTGAGGAAGATTGCTGTGGCTGCAGCGTCCAAGCCAGCAGTGGAGA
TCAAACAGGAGGGAGACACTTTCTACATCAAAACCTCCACCACCGTGCGCACCACAGAGA
TTAACTTCAAGGTTGGGGAGGAGTTTGAGGAGCAGACTGTGGATGGGAGGCCCTGTAAG
gtgagtgccagaaggggctccagggtcatggcgtcattgccctgcctctcaacctgccat
tttccaggctagcagttaactcctagcttctctctgtcccagtagggaaaatccctaggt
ggtggtgggggctagaaaggggctctctcccttatccctctcactgcattgcccctgcta

 1.03 Intr +   6126   6242  117  2  0  107  119   103 0.999  16.47
attgccctgcctctcaacctgccattttccaggctagcagttaactcctagcttctctct
gtcccagtagggaaaatccctaggtggtggtgggggctagaaaggggctctctcccttat
ccctctcactgcattgcccctgctatgggcccagctcacttggccacctgtctcttgcag
AGCCTGGTGAAATGGGAGAGTGAGAATAAAATGGTCTGTGAGCAGAAGCTCCTGAAGGGA
GAGGGCCCCAAGACCTCGTGGACCAGAGAACTGACCAACGATGGGGAACTGATCCTG
gtaagtcctgcctcctccccactaatagcaaacccagtgctaccttccaagattctctgg
gagaccccagggtgcaggagactcaagaacaaccatggctggactccgcaccctgctgat
gggactgcttgaacagaactaaggtgtccctatcccatacagtgccctgtgtgaattaga

 1.04 Intr +   6708   6754   47  2  2  130   70    79 0.994   8.00
attgctatcctccctccattgatgcctgggcattctgggaccagctcctgcctgttggtc
ttgagccaagaagcaggtttggacctggaggccaagcagagtacctccattcaaccctcc
tctccaaagccacaggaccccaggggcctctcaggctaacaactacttctgtccttccag
ACCATGACGGCGGATGACGTTGTGTGCACCAGGGTCTACGTCCGAGA
gtgagtggccacaggtagaaccgcggccgaagcccaccactggccatgctcaccgccctg
cttcactgccccctccgtcccaccccctccttctaggatagcgctccccttaccccagtc
acttctgggggtcactgggatgcctcttgcagggtcttgctttctttgacctcttctctc

 1.05 Intr +   7555   7658  104  1  2  123   72    94 0.967  11.62
cttctccaaggtccttccttggtgtcctgctctggcttccaaggtcacaagggcctcctc
ctcctgacctctcagctggggcactgggctctgaggagctgactcccaccttctcccatg
ttttccatcatggtgacagtttcctcctcctcctccagctgttgcttccctctcctccag
CTTCAGCCCATGGGTGACCCCAGGCCTGGCCTTGGCCTCCCACATGGTTCCAGATGAGCT
CAACGGCACCCACAAGCTGGCCTTGCAGCTGCCTGGGCCTCTGG
gtgagaggtctcatcctgcctgtcagccctttgtgtctgagacaagccatctctgctacc
atccttcctccctgcctcaatctcccacatgcccttctgcctctggcttctaaatcttcc
aggtcccttggatcctcctccaaccctctccctgagcctccacactcaggtctacaccag

Predicted peptide sequence(s):


>CRABP2_1|GENSCAN_predicted_peptide_1|173_aa
MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVR
TTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGEL
ILTMTADDVVCTRVYVRDFSPWVTPGLALASHMVPDELNGTHKLALQLPGPLX