GENSCAN 1.0	Date run: 14-Jan-104	Time: 20:24:17

Sequence COL8A2_1 : 7404 bp : 57.79% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1208   1400  193  1  1   89   72   328 0.700  28.58
actttgaaaattgcttgtgaataatatctaaattcggaattgcttctcagccttttgact
gaaatctccagtgtaatctctaaattctgatcttttggtgaccccgggcctagtgccaaa
ccacccagggctggcttgatgactttctctgttcttctttgcagcacgtccacggacgcc
ATGCTGGGGACTCTGACACCCCTGTCTTCGCTGCTGCTGCTGCTACTGGTGCTGGTGCTG
GGGTGTGGGCCGCGGGCGTCCTCTGGTGGCGGGGCCGGTGGGGCGGCGGGCTATGCCCCA
GTGAAGTACATCCAGCCCATGCAGAAAGGACCTGTGGGACCGCCCTTCCGTGAGGGCAAA
GGCCAGTACCTGG
gtgagagcctcctcaccccacagtgcctcaaatcgctcccagcccccaaatcccctgcct
ccctgagagccatcagatcctcaggcgccctccacagctcctcattccccaccaattttc
ctaccttcagtgtttttcctaataccccagagggcctggaaacggtgcagttagctggca

 1.02 Term +   1963   3881 1919  2  2  145   40  1388 0.645 126.91
cctgttgcccccaagatgtcccctgggccacccccaaaccccatcttccatgagagcagg
aaggggcagccccattcttcctctcccgtgtacctcatactggaatgggggaatgggtag
atggggtcccctgtccccacagttcaggcccctgactgcccctttctctttctttctcag
AAATGCCTCTACCGCTGCTGCCGATGGACCTGAAGGGAGAGCCCGGCCCCCCTGGGAAGC
CCGGGCCTCGGGGTCCCCCTGGCCCCCCTGGCTTCCCAGGAAAACCAGGCATGGGAAAGC
CAGGACTCCATGGGCAGCCTGGCCCTGCTGGGCCCCCTGGCTTCTCCCGGATGGGCAAGG
CTGGTCCCCCAGGGCTCCCTGGCAAGGTCGGGCCACCAGGGCAGCCGGGGCTTCGGGGGG
AGCCAGGAATACGAGGGGACCAGGGCCTCCGGGGACCCCCAGGACCCCCTGGCCTCCCGG
GCCCCTCAGGCATTACTATCCCTGGAAAACCAGGTGCCCAAGGGGTGCCAGGGCCCCCAG
GATTCCAGGGGGAACCAGGGCCCCAGGGGGAGCCTGGGCCCCCAGGTGATCGAGGCCTCA
AGGGGGATAATGGAGTGGGCCAGCCCGGGCTGCCTGGGGCCCCAGGGCAGGGGGGTGCCC
CCGGCCCCCCCGGCCTCCCTGGTCCAGCTGGCTTAGGCAAACCTGGTTTGGATGGGCTTC
CTGGGGCCCCAGGAGACAAGGGTGAGTCTGGGCCTCCTGGAGTTCCAGGCCCCAGGGGGG
AGCCAGGAGCTGTGGGCCCAAAAGGACCTCCTGGAGTAGACGGTGTGGGAGTCCCAGGGG
CAGCAGGGTTGCCAGGACCACAGGGCCCATCAGGGGCCAAAGGGGAGCCAGGGACCCGGG
GCCCCCCTGGGCTGATAGGCCCCACTGGCTATGGGATGCCAGGACTGCCAGGCCCCAAGG
GGGACAGGGGCCCAGCTGGGGTCCCAGGACTCTTGGGGGACAGGGGTGAGCCAGGGGAGG
ATGGGGAGCCAGGGGAGCAGGGCCCACAGGGTCTTGGGGGTCCCCCTGGACTTCCTGGGT
CTGCAGGGCTTCCTGGCAGACGTGGGCCCCCTGGGCCTAAGGGTGAGGCAGGGCCTGGAG
GACCCCCAGGAGTGCCTGGCATTCGAGGTGACCAGGGGCCTAGTGGCCTGGCTGGGAAAC
CAGGGGTCCCAGGTGAGAGGGGACTTCCTGGGGCCCATGGACCCCCTGGACCAACTGGGC
CCAAGGGTGAGCCGGGTTTCACGGGTCGCCCTGGAGGACCAGGGGTGGCAGGAGCCCTGG
GGCAGAAAGGTGACTTGGGGCTCCCTGGGCAGCCTGGCCTGAGGGGTCCCTCAGGAATCC
CAGGACTCCAGGGTCCAGCTGGCCCTATTGGGCCCCAAGGCCTGCCGGGCCTGAAGGGGG
AACCAGGCCTGCCAGGGCCCCCTGGAGAGGGGAGAGCAGGGGAACCTGGCACGGCTGGGC
CCACGGGGCCCCCAGGGGTCCCTGGCTCCCCTGGAATCACGGGCCCTCCGGGGCCTCCCG
GGCCCCCGGGACCCCCTGGTGCCCCTGGGGCCTTCGATGAGACTGGCATCGCAGGCTTGC
ACCTGCCCAACGGCGGTGTGGAGGGTGCCGTGCTGGGCAAGGGGGGCAAGCCACAGTTTG
GGCTGGGCGAGCTGTCTGCCCATGCCACACCGGCCTTCACTGCGGTGCTCACCTCGCCCT
TCCCCGCCTCGGGCATGCCCGTGAAATTTGACCGGACTCTCTACAATGGCCACAGCGGCT
ACAACCCAGCCACTGGCATCTTCACCTGCCCTGTGGGCGGCGTCTACTACTTTGCTTACC
ATGTGCACGTCAAGGGCACCAACGTGTGGGTGGCCCTGTACAAGAACAACGTGCCGGCCA
CCTATACCTACGATGAGTACAAGAAGGGCTACCTGGACCAGGCATCTGGTGGGGCCGTGC
TCCAGCTGCGGCCCAACGACCAGGTCTGGGTGCAGATGCCGTCGGACCAGGCCAACGGCC
TCTACTCCACGGAGTACATCCACTCCTCCTTTTCAGGATTCTTGCTCTGCCCCACATAA
cccgcggggggggtcctgctgccctggcctcctcccctttagtggtagagcgaccttttc
aattacaaagaacctcctggaaaaaaaaacaaaagctgaacagaggcggccgtggccttg
gcccgaggagactaacttgctttctccctgcatgcaggctgagattgtttctggaagggg

Predicted peptide sequence(s):


>COL8A2_1|GENSCAN_predicted_peptide_1|703_aa
MLGTLTPLSSLLLLLLVLVLGCGPRASSGGGAGGAAGYAPVKYIQPMQKGPVGPPFREGK
GQYLEMPLPLLPMDLKGEPGPPGKPGPRGPPGPPGFPGKPGMGKPGLHGQPGPAGPPGFS
RMGKAGPPGLPGKVGPPGQPGLRGEPGIRGDQGLRGPPGPPGLPGPSGITIPGKPGAQGV
PGPPGFQGEPGPQGEPGPPGDRGLKGDNGVGQPGLPGAPGQGGAPGPPGLPGPAGLGKPG
LDGLPGAPGDKGESGPPGVPGPRGEPGAVGPKGPPGVDGVGVPGAAGLPGPQGPSGAKGE
PGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPGLLGDRGEPGEDGEPGEQGPQGLGGPP
GLPGSAGLPGRRGPPGPKGEAGPGGPPGVPGIRGDQGPSGLAGKPGVPGERGLPGAHGPP
GPTGPKGEPGFTGRPGGPGVAGALGQKGDLGLPGQPGLRGPSGIPGLQGPAGPIGPQGLP
GLKGEPGLPGPPGEGRAGEPGTAGPTGPPGVPGSPGITGPPGPPGPPGPPGAPGAFDETG
IAGLHLPNGGVEGAVLGKGGKPQFGLGELSAHATPAFTAVLTSPFPASGMPVKFDRTLYN
GHSGYNPATGIFTCPVGGVYYFAYHVHVKGTNVWVALYKNNVPATYTYDEYKKGYLDQAS
GGAVLQLRPNDQVWVQMPSDQANGLYSTEYIHSSFSGFLLCPT