GENSCAN 1.0	Date run: 14-Jan-104	Time: 17:24:28

Sequence CEPT1_1 : 47242 bp : 36.62% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    818    855   38  1  2   70   90    57 0.573   1.71
actcggcatcaggcactgcttggggcaggaggagagtaggggaaaccaaggaagagaaca
gaaaggtagggcacggggagctgagcccagctgcactcatccccgcccccggaaaccccc
gcagctcccgccccaaccagcccccctctggcgcctggcataaggtagcccccggaggca
ATGAGGGCCAGCAGGAGTCTCGCGCGCCTGCGACGCGG
gtaagggggctccaggctgcgcccacttccccgagctgccagatcccaccctctgacgca
cccttctagagggagcgggctgcaagcgctggggcctgtcccttctcccctacttcgact
taccttaccagaccgactagcgctggccgctggcgccgaagcccctatgctaaaaggaga

 1.02 Intr +    925   1248  324  1  0   48   86   231 0.554  12.86
cccggaaacccccgcagctcccgccccaaccagcccccctctggcgcctggcataaggta
gcccccggaggcaatgagggccagcaggagtctcgcgcgcctgcgacgcgggtaaggggg
ctccaggctgcgcccacttccccgagctgccagatcccaccctctgacgcacccttctag
AGGGAGCGGGCTGCAAGCGCTGGGGCCTGTCCCTTCTCCCCTACTTCGACTTACCTTACC
AGACCGACTAGCGCTGGCCGCTGGCGCCGAAGCCCCTATGCTAAAAGGAGACAGGGCTGG
GCCACGGGGCGCGCTCCCGAGCAGACCGGCCGGCCCCGGGGCGCGCTCACGGCACCGAGG
AGCGCGCCTGCGGCGCTGCTCGTTCAAACCTTGTTCCCCTTTACGGCAATCGCGAAAGTG
TCGTGAACGTGCTGCCGCCGATCAGTCACCCAGTCGGCTGGAGTCGGAGGCGATATTTCT
AGGGGTGTACTTGTTGGGGTCAGG
gtaaggctgcggagcgcggtcaccggacgtgaaggatttgaagggcgttgtaggggccag
tggagagaggactggatgctctggggcgggtcattaggatatagctgtgtatggactcgc
gcgaggcgaacgccgtccttcttcctggcgcagggtggcctcgcgcgcggggttgtgggg

 1.03 Intr +   8790   8994  205  0  1    2  110    79 0.049  -0.22
aagaagggaaattactgtctttaaatattaaaaaaaaacaagatccatgagtgggcatcg
atcaacaaggaaaagatgtggagattctcacccggagtccccagtgggcttcgggcatat
gagtactacaggatgtgtattaaataaattgtttcagttaccaacaccaccattgtcaag
ACACCAACTAAAGCGGCTAGAAGAACACAGATATCAAAGTGCTGGACGGTCCCTGCTTGA
GCCCTTAATGCAAGGGTATTGGGAATGGCTCGTTAGAAGAGTTCCCTCCTGGATTGCCCC
AAATCTCATCACCATCATTGGACTGTCAATAAACATCTGTACAACTATTTTATTAGTCTT
CTACTGCCCTACAGCTACAGAGCAG
gtaagagtttcttaacagatctcaacatttgctatataccaaaaacgttgtaattgggat
cgtggggtcattttaactaaagataaagtaatctgacagctgtcaactattttaaaatat
cacacacactgtgataaagcttgtaagtacagcctacacacttgcttattggaaaccaga

 1.04 Intr +  20321  20468  148  1  1  102   72    73 0.570   5.99
ccaccgcgcccggcattcttttacaattctaattgtttcagtgagttcttcattatgtag
cacttggatcttctctcccatagcttccaactagctttccaacctgcaggtaaaaatatg
ttagtcaaacatggtaactgtgtgtctgaatactcttgcctttcttattttatttcacag
GCACCTCTGTGGGCATATATTGCTTGTGCCTGTGGCCTTTTCATTTACCAGTCTTTGGAT
GCTATTGATGGGAAACAGGCAAGAAGAACCAATAGTAGTTCTCCTCTGGGAGAACTTTTT
GATCATGGCTGTGATTCACTATCAACAG
gtattgttgatttttttaatgttattgattattaacaatggttaaaccagtgtgctaagc
agtgttagaatacatgtttagtcatgagaataagtaattttgtattaaattttagtattt
ctcaaaagactatgaacctagttaatatttgttcattattggtagtgttaggaaatttag

 1.05 Intr +  43228  43259   32  2  2   87   92    31 0.002   0.33
gaatatgaatcaaatattagactgttttcttattttagtttgtatatgttttaattgttt
tctctctctacccattaaagattccagtgctgaatattcaaatgaaaatttttcctgcac
tttgtactgtagcagggaccatattttcctgtacaaattacttccgtgtaatcttcacag
GTGGTGTTGGCAAAAATGGATCAACAATAGCA
gtaagtataccttaagattttcaacacttgtttacactaggacttggttttgttgtcatt
ttgttttttatttcaaatgtataaaatcatttgttaatttataatttatacttagccttt
aaagaaactaatgttcaaaacttcaattttatatatacttacccacatttatatgcttta

 1.06 Intr +  43740  43898  159  2  0  100   91    38 0.009   4.56
atgaatttatgctgctacttttcattagctcttctagtttgtgatttatagaaattgctg
cctatcaggcaccatgaggttcctgaaagtttgagttgaactgtgaactgttctgcagca
gatccatgtagtatctgatgagtactgaatactattaactcttctcttcactctgtacag
GGAACAAGTGTCCTTTCTCCTTTTCTCCATATTGGATCAGTGATTACATTAGCTGCAATG
ATCTACAAGAAATCTGCAGTTCAGCTTTTTGAAAAGCATCCCTGTCTTTATATACTGACA
TTTGGTTTTGTGTCTGCTAAAATCACTAATAAGCTTGTG
gtaagcacctgagtttttatttgctgtgtttttcactttcatcttattttggatttatgg
ctatagttctcattctgtagcttcataaatggtcctagagtttgccctcttctaatcaga
atctcttgatatcaacatgggaactatttttactcttttgtgaagctacaatttgaagtt

 1.07 Intr +  44403  44528  126  2  0   83  119     7 0.022   3.26
acatgatacatccctttctttctcagacgcatttcatattgttgggtttttagttttggg
aattcaacagctattcctaaataattattggaagttgatatctgagcacaatatgattta
ctgtgtagttcacaattgtcctcttatgaaaatgcctacgttattctgttttattcatag
GTTGCACACATGACGAAAAGTGAAATGCATTTGCATGACACAGCATTCATAGGTCCGGCA
CTTTTGTTTCTGGACCAGTATTTTAACAGCTTTATTGATGAATATATTGTACTTTGGATT
GCCCTG
gtaagtattgtactaagtcttatttcatggtttgagggtttgaaggttgcttgttttctt
attttgatgacccagtcatgaaagatcgttcatataattgtaatgatttggaatgtcaga
aatccacataaatggggctgtgtgagagttctatggctttatatttgagccttttatttt

Predicted peptide sequence(s):


>CEPT1_1|GENSCAN_predicted_peptide_1|344_aa
MRASRSLARLRRGGSGLQALGPVPSPLLRLTLPDRLALAAGAEAPMLKGDRAGPRGALPS
RPAGPGARSRHRGARLRRCSFKPCSPLRQSRKCRERAAADQSPSRLESEAIFLGVYLLGS
GHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPNLITIIGLSINICTTILLV
FYCPTATEQAPLWAYIACACGLFIYQSLDAIDGKQARRTNSSSPLGELFDHGCDSLSTGG
VGKNGSTIAGTSVLSPFLHIGSVITLAAMIYKKSAVQLFEKHPCLYILTFGFVSAKITNK
LVVAHMTKSEMHLHDTAFIGPALLFLDQYFNSFIDEYIVLWIAL