GENSCAN 1.0	Date run: 14-Jan-104	Time: 17:46:41

Sequence CENPF_1 : 63678 bp : 40.94% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.03 PlyA -   1630   1625    6                               1.05
 1.02 Term -   3989   3380  610  1  1   87   43   729 0.366  61.28
 1.01 Init -   6750   6224  527  0  2   97   94   523 0.363  46.17
 1.00 Prom -   8724   8685   40                              -2.35

 2.01 Init +  11665  11826  162  0  0   63   75   177 0.997  13.68
gataggtattatactttgttatcttttgaaatgtggtcttgaaacttgatttttaggggt
ggttagatagattcattaatttctgagactttgtttccttttactgtggtaagaccaaca
gtctggttattcttttcagtttatttacaaatgttggagtaataaagaaggcagaacaaa
ATGAGCTGGGCTTTGGAAGAATGGAAAGAAGGGCTGCCTACAAGAGCTCTTCAGAAAATT
CAAGAGCTTGAAGGACAGCTTGACAAACTGAAGAAGGAAAAGCAGCAAAGGCAGTTTCAG
CTTGACAGTCTCGAGGCTGCGCTGCAGAAGCAAAAACAGAAG
gtacccctgaagctctggtatttgtagctgttcactcattattgacagagaagtgctggt
atttaaaactgttcactcatttttggattaattatttcatcttctttacatttagagaaa
aatgattttgctgtcttcaggtggtaattcctctcccctcccccacccccaccccaggcc

 2.02 Intr +  12742  12938  197  0  2   13   85   183 0.998   7.79
tcaaagaagtttcctatctattggcttcaaagtgtgatcatctaaaatttctgtgttcat
atggcttattgcagctgtatctcaggaatttagtagtcaatgttagactcaggtttacca
ataatacttggtaaattcacaaaataagggagttattgtcttctgaacaattctcattag
GTTGAAAATGAAAAAACCGAGGGTACAAACCTGAAAAGGGAGAATCAAAGATTGATGGAA
ATATGTGAAAGTCTGGAGAAAACTAAGCAGAAGATTTCTCATGAACTTCAAGTCAAGGAG
TCACAAGTGAATTTCCAGGAAGGACAACTGAATTCAGGCAAAAAACAAATAGAAAAACTG
GAACAGGAACTTAAAAG
gtaatattttgggatggtatttatagggatgatatttgtatgtattaatcagatgcgttt
gtcttttcctttaacaatataattattatactttgcaattttttttcctggtagaataag
taatgattcggtctctgtaccgtaacttgaaagagtggaagattaaaaacaaacaaacag

 2.03 Intr +  16483  16604  122  1  2   99   40    59 0.963   1.42
gtttatgtctggcacataagttagaccttatgaaatgcctgttggataaatgaaatggtt
aagaattcttagtggatgggtttctttgtaagtttattactctctgggaatgtaaggcat
tgatattctgtagcctttgctctaactgatttgtctgcctcttgggtccttttctaacag
GTGTAAATCTGAGCTTGAAAGAAGCCAACAAGCTGCGCAGTCTGCAGATGTCTCTCTGAA
TCCATGCAATACACCACAAAAAATTTTTACAACTCCACTAACACCAAGTCAATATTATAG
TG
gtaatgcattttcttccttggtatagacagctttttgtttagcttgagattttaattctg
caaaataaatgaattaattcaactttgaattaaacttttaatgtatatgtttaaaaactg
cagccacttgttacatatccatttgcatatctgttgaattatgttgagctactggattga

 2.04 Intr +  17039  17130   92  0  2   76  106    98 0.987   9.19
tatgtttttatgtgttttgatatttgagtaatttgatcaatagtttgatctatttcccta
accaaaatgttgtttctactaagatactcatttctagactatcaaaatcgttgttgatct
gtgaattccttcatggaatcaatgactgaaagaaaactgtatttgattgtctgtttctag
GTTCCAAGTATGAAGATCTAAAAGAAAAATATAATAAAGAGGTTGAAGAACGAAAAAGAT
TAGAGGCAGAGGTTAAAGCCTTGCAGGCTAAA
gtaagttaattatgggccctataatagagtatgcagttatagaatactttgatatagaat
agaacaaggttagagaaaaatctgttttacatagagctggcctttttgtgtgtgtgtgtg
ctgagaaaaggttttgggctcagtggaggtgattattttttagttttaaaaatagggtgg

 2.05 Intr +  18565  18856  292  0  1   44   87   182 0.913   9.48
ttagaacattccatcactgggtattagacttatggtttacttgacttgatgaatgttctt
tgttggtatgcagtgcaactgttaacttcttgggattatggctttatattctatctgaaa
ataaatagccttgagtatataagatctttaaaggcctctaaagagattctgtttctacag
AAAGCAAGCCAGACTCTTCCACAAGCCACCATGAATCACCGCGACATTGCCCGGCATCAG
GCTTCATCATCTGTGTTCTCATGGCAGCAAGAGAAGACCCCAAGTCATCTTTCATCTAAT
TCTCAAAGAACTCCAATTAGGAGAGATTTCTCTGCATCTTACTTTTCTGGGGAACAAGAG
GTGACTCCAAGTCGATCAACTTTGCAAATAGGGAAAAGAGATGCTAATAGCAGTTTCTTT
GACAATTCTAGCAGTCCTCATCTTTTGGATCAATTAAAAGCGCAGAATCAAG
gtaacattgagctaagttaagtttaaattcactttgcttgaggtaatttcacaggtgatt
tcagatatttttaatcccataaagtgcttatgtgttttgttaggcacatcggtgttcaac
atcctagactggttatgtgaaatatactgtcttttcaataatgataaaaggcatcatagt

 2.06 Intr +  19989  20191  203  1  2   32   75   203 0.640  11.48
gaatgcaaatgacaatagaaactaactattgaaattaaatccaattaaagtagcttctgt
atttagtgtaaatatttgtttcgtcaaagatttcagaaaagaataaaacaaatgataagt
tatgaacattttgggaaagatatatatgaattggagtgtgatttttgtttgtggttcaag
AGCTAAGAAACAAGATTAATGAGTTGGAACTACGCCTGCAAGGACATGAAAAAGAAATGA
AAGGCCAAGTGAATAAGTTTCAAGAACTCCAACTCCAACTGGAGAAAGCAAAAGTGGAAT
TAATTGAAAAAGAGAAAGTTTTGAACAAATGTAGGGATGAACTAGTGAGAACAACAGCAC
AATACGACCAGGCGTCAACCAAG
gtacttgacttttcgtgaattactggagaaatcttcatcttttcatacaattatttagaa
agagtattttatacataagtttatgaaatgtcagtaatgttctttgttaatatatattag
gtactcttgatgcaactgaactagaaagctgttttaagttgggcagatccgggatcaagc

 2.07 Intr +  26956  27081  126  0  0   45   94   133 0.998   9.56
ttcatggcacaaattaggaagtatttatttaagtgggctaatgctttacatccttgctaa
tagttcctaaacataaattgtgtgctaaaacaattatagcagtttttctaaaacacaaaa
tatttgttcatttatgtgagtaatatttattttgtcttgaacatttttattcattattag
TATACTGCATTGGAACAAAAACTGAAAAAATTGACGGAAGATTTGAGTTGTCAGCGACAA
AATGCAGAAAGTGCCAGATGTTCTCTGGAACAGAAAATTAAGGAAAAAGAAAAGGAGTTT
CAAGAG
gtaaggtaaatggattcatgaggtgtttgtctgaaaggctttttatgggcttttcatagt
ttgatcacttggaaaggggagttgttatcacaatttgggaaattctcttagaggagaaat
gctttgtgagctaaaggtcatcttattttctttcacatcttcacttttgcgcttttttta

 2.08 Intr +  28444  28572  129  0  0  116   28   134 0.993  10.17
gcctgagggcagcatggagcaccaaggctgactatgttcatcgttaagtggacagttggc
tcagctccctgctgtctcctgtgctctctgtgcagtcgcctgttaggatgctcatgcctc
accctggagtctccctagcgaaccatcatcaggctgatgcacctgccctttgtttttcag
GAGCTCTCCCGTCAACAGCGTTCTTTCCAAACACTGGACCAGGAGTGCATCCAGATGAAG
GCCAGACTCACCCAGGAGTTACAGCAAGCCAAGAATATGCACAACGTCCTGCAGGCTGAA
CTGGATAAA
gtaggggccgtgtctctctctctctccttaatcatcccctcttgttccttgtacttgtta
cttctctaccataactgacatatgatactttcaaagaaaaagcgctccaccttcactttc
cctatcaaagtggagaatgtacagaaccattctggctctaggtttcctcatctagagaaa

 2.09 Intr +  30390  30512  123  2  0   93   94    79 0.816   8.86
cgtcgcaaggtcacattatggtattttaagacatatttagctgtgacgtatactgtatct
cagccaaaatagatggcatccattttgatattccatgaccattttattgtttaagaatac
atgattaatgaaaaagtaaagaacatgaaaatgaaacttggtctctttttctttttgtag
CTCACATCAGTAAAGCAACAGCTAGAAAACAATTTGGAAGAGTTTAAGCAAAAGTTGTGC
AGAGCTGAACAGGCGTTCCAGGCGAGTCAGATCAAGGAGAATGAGCTGAGGAGAAGCATG
GAG
gtaagggaggaggatgccgaattttctccacttatgtaagaaccaagtgcaaggggaaaa
gaatattcctattccatttgtcagttgcttgtcatgactgtgtgcctttttcttttctat
tcaccagaagtaagtattacagaattttctgtatataacccatgacagaatatgattgct

 2.10 Intr +  35776  35911  136  0  1   65  115    91 0.969   8.72
ctgttcataacattatttaagtaagaatgtctgacttcattaggtactcaaacggggaaa
ttgtgattctttccctagtgagatacacaaacagttctgctagggacctttattaaggca
gaagtcataacttacttgagcattcgttttggctataaccaattaaaatgtgtgttttag
GAAATGAAGAAGGAAAACAACCTCCTTAAGAGTCACTCTGAGCAAAAGGCCAGAGAAGTC
TGCCACCTGGAGGCAGAACTCAAGAACATCAAACAGTGTTTAAATCAGAGCCAGAATTTT
GCAGAAGAAATGAAAG
gtaagtaaacttagtattttagagttacctttctaagctgctattcccgtgagaggggat
ggatggcattaacatattagagaaactctttggattttttttcatatattccctcaaaaa
gatgtgcgcagttgatgtggaagagttttccctcttctagtttttagtttccagagtgag

 2.11 Intr +  37831  41234 3404  2  2   69   95  2820 0.997 267.20
aagataattaccaagtgatccactttctaggaggtacccaggcaataatgccagtttttc
cagggcttgagtagttgttagtttgtttggattttgccagggggcggggggaggggttag
cgtttctgtagaataaacatttattacaaacattgacgacttttatttatttttaaatag
CGAAGAATACCTCTCAGGAAACCATGTTAAGAGATCTTCAAGAAAAAATAAATCAGCAAG
AAAACTCCTTGACTTTAGAAAAACTGAAGCTTGCTGTGGCTGATCTGGAAAAGCAGCGAG
ATTGTTCTCAAGACCTTTTGAAGAAAAGAGAACATCACATTGAACAACTTAATGATAAGT
TAAGCAAGACAGAGAAAGAGTCCAAAGCCTTGCTGAGTGCTTTAGAGTTAAAAAAGAAAG
AATATGAAGAATTGAAAGAAGAGAAAACTCTGTTTTCTTGTTGGAAAAGTGAAAACGAAA
AACTTTTAACTCAGATGGAATCAGAAAAGGAAAACTTGCAGAGTAAAATTAATCACTTGG
AAACTTGTCTGAAGACACAGCAAATAAAAAGTCATGAATACAACGAGAGAGTAAGAACGC
TGGAGATGGACAGAGAAAACCTAAGTGTCGAGATCAGAAACCTTCACAACGTGTTAGACA
GTAAGTCAGTGGAGGTAGAGACCCAGAAACTAGCTTATATGGAGCTACAGCAGAAAGCTG
AGTTCTCAGATCAGAAACATCAGAAGGAAATAGAAAATATGTGTTTGAAGACTTCTCAGC
TTACTGGGCAAGTTGAAGATCTAGAACACAAGCTTCAGTTACTGTCAAATGAAATAATGG
ACAAAGACCGGTGTTACCAAGACTTGCATGCCGAATATGAGAGCCTCAGGGATCTGCTAA
AATCCAAAGATGCTTCTCTGGTGACAAATGAAGATCATCAGAGAAGTCTTTTGGCTTTTG
ATCAGCAGCCTGCCATGCATCATTCCTTTGCAAATATAATTGGAGAACAAGGAAGCATGC
CTTCAGAGAGGAGTGAATGTCGTTTAGAAGCAGACCAAAGTCCGAAAAATTCTGCCATCC
TACAAAATAGAGTTGATTCACTTGAATTTTCATTAGAGTCTCAAAAACAGATGAACTCAG
ACCTGCAAAAGCAGTGTGAAGAGTTGGTGCAAATCAAAGGAGAAATAGAAGAAAATCTCA
TGAAAGCAGAACAGATGCATCAAAGTTTTGTGGCTGAAACAAGTCAGCGCATTAGTAAGT
TACAGGAAGACACTTCTGCTCACCAGAATGTTGTTGCTGAAACCTTAAGTGCCCTTGAGA
ACAAGGAAAAAGAGCTGCAACTTTTAAATGATAAGGTAGAAACTGAGCAGGCAGAGATTC
AAGAATTAAAAAAGAGCAACCATCTACTTGAAGACTCTCTAAAGGAGCTACAACTTTTAT
CCGAAACCCTAAGCTTGGAGAAGAAAGAAATGAGTTCCATCATTTCTCTAAATAAAAGGG
AAATTGAAGAGCTGACCCAAGAGAATGGGACTCTTAAGGAAATTAATGCATCCTTAAATC
AAGAGAAGATGAACTTAATCCAGAAAAGTGAGAGTTTTGCAAACTATATAGATGAAAGGG
AGAAAAGCATTTCAGAGTTATCTGATCAGTACAAGCAAGAAAAACTTATTTTACTACAAA
GATGTGAAGAAACCGGAAATGCATATGAGGATCTTAGTCAAAAATACAAAGCAGCACAGG
AAAAGAATTCTAAATTAGAATGCTTGCTAAATGAATGCACTAGTCTTTGTGAAAATAGGA
AAAATGAGTTGGAACAGCTAAAGGAAGCATTTGCAAAGGAACACCAAGAATTCTTAACAA
AATTAGCATTTGCTGAAGAAAGAAATCAGAATCTGATGCTAGAGTTGGAGACAGTGCAGC
AAGCTCTGAGATCTGAGATGACAGATAACCAAAACAATTCTAAGAGCGAGGCTGGTGGTT
TAAAGCAAGAAATCATGACTTTAAAGGAAGAACAAAACAAAATGCAAAAGGAAGTTAATG
ACTTATTACAAGAGAATGAACAGCTGATGAAGGTAATGAAGACTAAACATGAATGTCAAA
ATCTAGAATCAGAACCAATTAGGAACTCTGTGAAAGAAAGAGAGAGTGAGAGAAATCAAT
GTAATTTTAAACCTCAGATGGATCTTGAAGTTAAAGAAATTTCTCTAGATAGTTATAATG
CGCAGTTGGTGCAATTAGAAGCTATGCTAAGAAATAAGGAATTAAAACTTCAGGAAAGTG
AGAAGGAGAAGGAGTGCCTGCAGCATGAATTACAGACAATTAGAGGAGATCTTGAAACCA
GCAATTTGCAAGACATGCAGTCACAAGAAATTAGTGGCCTTAAAGACTGTGAAATAGATG
CGGAAGAAAAGTATATTTCAGGGCCTCATGAGTTGTCAACAAGTCAAAACGACAATGCAC
ACCTTCAGTGCTCTCTGCAAACAACAATGAACAAGCTGAATGAGCTAGAGAAAATATGTG
AAATACTGCAGGCTGAAAAGTATGAACTCGTAACTGAGCTGAATGATTCAAGGTCAGAAT
GTATCACAGCAACTAGGAAAATGGCAGAAGAGGTAGGGAAACTACTAAATGAAGTTAAAA
TATTAAATGATGACAGTGGTCTTCTCCATGGTGAGTTAGTGGAAGACATACCAGGAGGTG
AATTTGGTGAACAACCAAATGAACAGCACCCTGTGTCTTTGGCTCCATTGGACGAGAGTA
ATTCCTACGAGCACTTGACATTGTCAGACAAAGAAGTTCAAATGCACTTTGCCGAATTGC
AAGAGAAATTCTTATCTTTACAAAGTGAACACAAAATTTTACATGATCAGCACTGTCAGA
TGAGCTCTAAAATGTCAGAGCTGCAGACCTATGTTGACTCATTAAAGGCCGAAAATTTGG
TCTTGTCAACGAATCTGAGAAACTTTCAAGGTGACTTGGTGAAGGAGATGCAGCTGGGCT
TGGAGGAGGGGCTCGTTCCATCCCTGTCATCCTCTTGTGTGCCTGACAGCTCTAGTCTTA
GCAGTTTGGGAGACTCCTCCTTTTACAGAGCTCTTTTAGAACAGACAGGAGATATGTCTC
TTTTGAGTAATTTAGAAGGGGCTGTTTCAGCAAACCAGTGCAGTGTAGATGAAGTATTTT
GCAGCAGTCTGCAGGAGGAGAATCTGACCAGGAAAGAAACCCCTTCGGCCCCAGCGAAGG
GTGTTGAAGAGCTTGAGTCCCTCTGTGAGGTGTACCGGCAGTCCCTCGAGAAGCTAGAAG
AGAAAATGGAAAGTCAAGGGATTATGAAAAATAAGGAAATTCAAGAGCTCGAGCAGTTAT
TAAGTTCTGAAAGGCAAGAGCTTGACTGCCTTAGGAAGCAGTATTTGTCAGAAAATGAAC
AGTGGCAACAGAAGCTGACAAGCGTGACTCTGGAGATGGAGTCCAAGTTGGCGGCAGAAA
AGAAACAGACGGAACAACTGTCACTTGAGCTGGAAGTAGCACGACTCCAGCTACAAGGTC
TGGACTTAAGTTCTCGGTCTTTGCTTGGCATCGACACAGAAGAT
gtaagtacctgggatttaaatgccatttctcggtttacatgactagtggacactcagtaa
atgtttgtctaattgaaatgtacattaaacctaagttaaaatatttttagggttcaagga
aataaaatacaccaaaatattttcaaaacaaaccagaacttgaggaaaatgagtaaacgt

 2.12 Intr +  42467  45310 2844  1  0   47  106  2688 0.991 252.89
acgtataagtatgttgaacatttgaatgaagagagaaagatgtagtgggaaattcaccac
tttaagagatgtgtttagcagaggccacgcatcagtttctaaaaagtaataactaaatct
attctattttgattctttttgaaaaataaaatgcatgcttgttatgtattataattacag
GCTATTCAAGGCCGAAATGAGAGCTGTGACATATCAAAAGAACATACTTCAGAAACTACA
GAAAGAACACCAAAGCATGATGTTCATCAGATTTGTGATAAAGATGCTCAGCAGGACCTC
AATCTAGACATTGAGAAAATAACTGAGACTGGTGCAGTGAAACCCACAGGAGAGTGCTCT
GGGGAACAGTCCCCAGATACCAATTATGAGCCTCCAGGGGAAGATAAAACCCAGGGCTCT
TCAGAATGCATTTCTGAATTGTCATTTTCTGGTCCTAATGCTTTGGTACCTATGGATTTC
CTGGGGAATCAGGAAGATATCCATAATCTTCAACTGCGGGTAAAAGAGACATCAAATGAG
AATTTGAGATTACTTCATGTGATAGAGGACCGTGACAGAAAAGTTGAAAGTTTGCTAAAT
GAAATGAAAGAATTAGACTCAAAACTCCATTTACAGGAGGTACAACTAATGACCAAAATT
GAAGCATGCATAGAATTGGAAAAAATAGTTGGGGAACTTAAGAAAGAAAACTCAGATTTA
AGTGAAAAATTGGAATATTTTTCTTGTGATCACCAGGAGTTACTCCAGAGAGTAGAAACT
TCTGAAGGCCTCAATTCTGATTTAGAAATGCATGCAGATAAATCATCACGTGAAGATATT
GGAGATAATGTGGCCAAGGTGAATGACAGCTGGAAGGAGAGATTTCTTGATGTGGAAAAT
GAGCTGAGTAGGATCAGATCGGAGAAAGCTAGCATTGAGCATGAAGCCCTCTACCTGGAG
GCTGACTTAGAGGTAGTTCAAACAGAGAAGCTATGTTTAGAAAAAGACAATGAAAATAAG
CAGAAGGTTATTGTCTGCCTTGAAGAAGAACTCTCAGTGGTCACAAGTGAGAGAAACCAG
CTTCGTGGAGAATTAGATACTATGTCAAAAAAAACCACGGCACTGGATCAGTTGTCTGAA
AAAATGAAGGAGAAAACACAAGAGCTTGAGTCTCATCAAAGTGAGTGTCTCCATTGCATT
CAGGTGGCAGAGGCAGAGGTGAAGGAAAAGACGGAACTCCTTCAGACTTTGTCCTCTGAT
GTGAGTGAGCTGTTAAAAGACAAAACTCATCTCCAGGAAAAGCTGCAGAGTTTGGAAAAG
GACTCACAGGCACTGTCTTTGACAAAATGTGAGCTGGAAAACCAAATTGCACAACTGAAT
AAAGAGAAAGAATTGCTTGTCAAGGAATCTGAAAGCCTGCAGGCCAGACTGAGTGAATCA
GATTATGAAAAGCTGAATGTCTCCAAGGCCTTGGAGGCCGCACTGGTGGAGAAAGGTGAG
TTCGCATTGAGGCTGAGCTCAACACAGGAGGAAGTGCATCAGCTGAGAAGAGGCATCGAG
AAACTGAGAGTTCGCATTGAGGCCGATGAAAAGAAGCAGCTGCACATCGCAGAGAAACTG
AAAGAACGCGAGCGGGAGAATGATTCACTTAAGGATAAAGTTGAGAACCTTGAAAGGGAA
TTGCAGATGTCAGAAGAAAACCAGGAGCTAGTGATTCTTGATGCCGAGAATTCCAAAGCA
GAAGTAGAGACTCTAAAAACACAAATAGAAGAGATGGCCAGAAGCCTGAAAGTTTTTGAA
TTAGACCTTGTCACGTTAAGGTCTGAAAAAGAAAATCTGACAAAACAAATACAAGAAAAA
CAAGGTCAGTTGTCAGAACTAGACAAGTTACTCTCTTCATTTAAAAGTCTGTTAGAAGAA
AAGGAGCAAGCAGAGATACAGATCAAAGAAGAATCTAAAACTGCAGTGGAGATGCTTCAG
AATCAGTTAAAGGAGCTAAATGAGGCAGTAGCAGCCTTGTGTGGTGACCAAGAAATTATG
AAGGCCACAGAACAGAGTCTAGACCCACCAATAGAGGAAGAGCATCAGCTGAGAAATAGC
ATTGAAAAGCTGAGAGCCCGCCTAGAAGCTGATGAAAAGAAGCAGCTCTGTGTCTTACAA
CAACTGAAGGAAAGTGAGCATCATGCAGATTTACTTAAGGGTAGAGTGGAGAACCTTGAA
AGAGAGCTAGAGATAGCCAGGACAAACCAAGAGCATGCAGCTCTTGAGGCAGAGAATTCC
AAAGGAGAGGTAGAGACCCTAAAAGCAAAAATAGAAGGGATGACCCAAAGTCTGAGAGGT
CTGGAATTAGATGTTGTTACTATAAGGTCAGAAAAAGAAAATCTGACAAATGAATTACAA
AAAGAGCAAGAGCGAATATCTGAATTAGAAATAATAAATTCATCATTTGAAAATATTTTG
CAAGAAAAAGAGCAAGAGAAAGTACAGATGAAAGAAAAATCAAGCACTGCCATGGAGATG
CTTCAAACACAATTAAAAGAGCTCAATGAGAGAGTGGCAGCCCTGCATAATGACCAAGAA
GCCTGTAAGGCCAAAGAGCAGAATCTTAGTAGTCAAGTAGAGTGTCTTGAACTTGAGAAG
GCTCAGTTGCTACAAGGCCTTGATGAGGCCAAAAATAATTATATTGTTTTGCAATCTTCA
GTGAATGGCCTCATTCAAGAAGTAGAAGATGGCAAGCAGAAACTGGAGAAGAAGGATGAA
GAAATCAGTAGACTGAAAAATCAAATTCAAGACCAAGAGCAGCTTGTCTCTAAACTGTCC
CAGGTGGAAGGAGAGCACCAACTTTGGAAGGAGCAAAACTTAGAACTGAGAAATCTGACA
GTGGAATTGGAGCAGAAGATCCAAGTGCTACAATCCAAAAATGCCTCTTTGCAGGACACA
TTAGAAGTGCTGCAGAGTTCTTACAAGAATCTAGAGAATGAGCTTGAATTGACAAAAATG
GACAAAATGTCCTTTGTTGAAAAA
gtaagtggctatatctgtttatgtttaaatatgtagtcatgaggcaggaaaccatatttt
cttctagacactgtgaattgtatttacttctagaccgtgtctgctatattggaccaaact
ttgtaaaggctttatgtttactgggtcttgaattgcagaaacactgagttggctctggca

 2.13 Intr +  46585  46737  153  0  0  -32  106   134 0.399   2.55
taagcttactagtaggttttgagaatgttgagttgagtggattagtaaaggcgggattag
ccagcttccattttatgattgaaggctaaaataaatggcatgaatatgttgtatcagagt
ggtcgatctgatcaaaacagaccaccaaaaagcagattctaatgaaagatgaaatttcag
GTAAACAAAATGACTGCAAAGGAAACTGAGCTGCAGAGGGAAATGCATGAGATGGCACAG
AAAACAGCAGAGCTGCAAGAAGAACTCAGTGGAGAGAAAAATAGGCTAGCTGGAGAGTTG
CAGTTACTGTTGGAAGAAATAAAGAGCAGCAAA
gtaagtttctttgtgacaagtgttattatgatctgttaattcattgtgcacactctcctt
attggttcctgtaagaccttctgttgtttacctaacttatttttagctcttgaaaaaaat
aaccctgtgcttatgtcataatctgatttatagtaatctctaccatccagcactatcagg

 2.14 Intr +  49620  49796  177  2  0   76   67   156 0.998  11.49
tggaggtgaagtcacaattaaaagtgaatacattgctaaggattatagcactattctgta
cagattttatcttgcccataaatattttttttctacacagtacacattatttcctaaaaa
tatttccaggttcttaattatgaggaggtgctattatgattttattatttttctgtttag
GATCAATTGAAGGAGCTCACACTAGAAAATAGTGAATTGAAGAAGAGCCTAGATTGCATG
CACAAAGACCAGGTGGAAAAGGAAGGGAAAGTGAGAGAGGAAATAGCTGAATATCAGCTA
CGGCTTCATGAAGCTGAAAAGAAACACCAGGCTTTGCTTTTGGACACAAACAAACAG
gtgaaatgtggggtttggttactgggggagctggagagtgtattttgatcatggtaaggc
ttttttttttttccaaaaaaaatcaatattctgggttattactatgctatataatctttt
aaaaggtctcacattaacttcacgatcttttccccaggtccctctcttattttatcagtt

 2.15 Intr +  50738  50899  162  1  0   55   95   170 0.999  13.65
ttggccaggatggccttgaactcctgacctcgtgatctgcccaccttggcctcccaaagt
gctgggattacaggtgtgaaacactgcgcccagctgttttttgtttttctgactattttt
ttttagctgtgcctcctggctaaagtaacattttggttttttttgtttgttttgctctag
TATGAAGTAGAAATCCAGACATACCGAGAGAAATTGACTTCTAAAGAAGAATGTCTCAGT
TCACAGAAGCTGGAGATAGACCTTTTAAAGTCTAGTAAAGAAGAGCTCAATAATTCATTG
AAAGCTACTACTCAGATTTTGGAAGAATTGAAGAAAACCAAG
gtatgttcactttaatttgcttcatgatttcgaatggtttatacaggtggtagtgatttt
aatggtatagcattaaacgttttcattttcattttatgaaaatttttggtagtcaaaaat
gatgtcattcatcagttctctgctgagttatctttaaaaaaaatcagtgggtcatctaca

 2.16 Intr +  53151  53313  163  2  1   69   94   139 0.998  11.23
tggggggacttaggaaactgagtagagaacgtgaatggttttgtgcatctttagatgttt
tgtattgaatctaataattcttaaatttacaatatatgaatcttatatcttataattatt
tttccatatgcttataaaaagaaattcaaggttttaaatggaattacttttattttgtag
ATGGACAATCTAAAATATGTAAATCAGTTGAAGAAGGAAAATGAACGTGCCCAGGGGAAA
ATGAAGTTGTTGATCAAATCCTGTAAACAGCTGGAAGAGGAAAAGGAGATACTGCAGAAA
GAACTCTCTCAACTTCAAGCTGCACAGGAGAAGCAGAAAACAG
gtgggtgttaactggggcacatcaactagccagaactcttttccagtagtgaaataacat
atggtatgcgtgcataggaactatttttagtgctgtgttctattactgagtgctgatttt
ttaccattaatccattttccaatttctgaattttgtgcttatcttgggatcattatagga

 2.17 Intr +  54843  55319  477  1  0   72   91   424 0.969  33.19
atgatatacctcccgaacaagagttgtttgaactataagaacatatacagatatatctcc
ccaacctcttaaaaaaaaaaatcaaagaaagaacacgtctaagattatctgcttcacgat
gcccattgttaactagagaagcatcaagttgcacatgatgtgttgctttactttggacag
GTACTGTTATGGATACCAAGGTCGATGAATTAACAACTGAGATCAAAGAACTGAAAGAAA
CTCTTGAAGAAAAAACCAAGGAGGCAGATGAATACTTGGATAAGTACTGTTCCTTGCTTA
TAAGCCATGAAAAGTTAGAGAAAGCTAAAGAGATGTTAGAGACACAAGTGGCCCATCTGT
GTTCACAGCAATCTAAACAAGATTCCCGAGGGTCTCCTTTGCTAGGTCCAGTTGTTCCAG
GACCATCTCCAATCCCTTCTGTTACTGAAAAGAGGTTATCATCTGGCCAAAATAAAGCTT
CAGGCAAGAGGCAAAGATCCAGTGGAATATGGGAGAATGGTAGAGGACCAACACCTGCTA
CCCCAGAGAGCTTTTCTAAAAAAAGCAAGAAAGCAGTCATGAGTGGTATTCACCCTGCAG
AAGACACGGAAGGTACTGAGTTTGAGCCAGAGGGACTTCCAGAAGTTGTAAAGAAAG
gtatgcctaatttaaagacaaaattatttgtgttcttttgaaattccatataatggttca
catataaaaagacaaaagtatttgcttttttacattattgtgcaataatctcattgacgt
tcataagcaatagtctgcttttaaatggatgaggcatatgttttcctctaggatctaatt

 2.18 Intr +  56760  56938  179  1  2   94   92   169 0.979  16.62
tttgattcaatttggtgactcccagggcaactgtgaagtgtaatccattgaccacagtgg
ctaggacaaagtattttttggagtttgcattatccttgttaaaaccacctaatgaatatc
ttttccactgtagatagaattggacctagcagtgctgacagttattttttttgcccttag
GGTTTGCTGACATCCCGACAGGAAAGACTAGCCCATATATCCTGCGAAGAACAACCATGG
CAACTCGGACCAGCCCCCGCCTGGCTGCACAGAAGTTAGCGCTATCCCCACTGAGTCTCG
GCAAAGAAAATCTTGCAGAGTCCTCCAAACCAACAGCTGGTGGCAGCAGATCACAAAAG
gtaaactactgtcaacatccgtctactgtttgagatccagaaaattgcagtagtacctgg
gtgaggattggacactgcacccccgattcaggagcgctttcaaaaagtctgaccttcttg
gtgtggtgtaagtcagtcagtagtgagcaagtgaccgggtgagcattacagtatcagggt

 2.19 Term +  61501  61704  204  0  0   78   49   201 0.893  11.59
gtatcctcctaagttctctgttagatggggcctgttctcaaggaagaggaaatacttcaa
ttatatataactcctagagaagaagaacttaatttaaaacttagtgacatagtgctttat
ttttcatgttgtggaaatgtgaatgtgattgaacctctaacagagatgtttgtgttgcag
GTCAAAGTTGCTCAGCGGAGCCCAGTAGATTCAGGCACCATCCTCCGAGAACCCACCACG
AAATCCGTCCCAGTCAATAATCTTCCTGAGAGAAGTCCGACTGACAGCCCCAGAGAGGGC
CTGAGGGTCAAGCGAGGCCGACTTGTCCCCAGCCCCAAAGCTGGACTGGAGTCCAACGGC
AGTGAGAACTGTAAGGTCCAGTGA
aggcactttgtgtgtcagtacccctgggaggtgccagtcattgaatagataaggctgtgc
ctacaggacttctctttagtcagggcatgctttattagtgaggagaaaacaattccttag
aagtcttaaatatattgtactctttagatctcccatgtgtaggtattgaaaaagtttgga

Predicted peptide sequence(s):


>CENPF_1|GENSCAN_predicted_peptide_1|378_aa
MNGLSLSELCCLFCCPPCPGRIAAKLAFLPPEATYSLVTEPEPGPGGAGAAPLGTLRASS
GAPGRWKLHLTERADFQYSQRELDTIEVFPTKSARRNRVSCMYVRCVTGARYTVLFSHSN
AVDLGQMSSFYIGLGSRLHCNIFSYDYSGYGASSGRPSERNLYADIDAAWQALRTRYGIS
PDSIILYGQSIGTVPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKV
SKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPLWVEGTRHNDIELYSQYLEGLRRF
ISQELPASSPSGGTNRPDLSNKAAPGPHPAPAPQGLHVDPRAAQGTPLQPRGCGRCTGNR
ATHSFPFGSKKKIRENRN

>CENPF_1|GENSCAN_predicted_peptide_2|3114_aa
MSWALEEWKEGLPTRALQKIQELEGQLDKLKKEKQQRQFQLDSLEAALQKQKQKVENEKT
EGTNLKRENQRLMEICESLEKTKQKISHELQVKESQVNFQEGQLNSGKKQIEKLEQELKR
CKSELERSQQAAQSADVSLNPCNTPQKIFTTPLTPSQYYSGSKYEDLKEKYNKEVEERKR
LEAEVKALQAKKASQTLPQATMNHRDIARHQASSSVFSWQQEKTPSHLSSNSQRTPIRRD
FSASYFSGEQEVTPSRSTLQIGKRDANSSFFDNSSSPHLLDQLKAQNQELRNKINELELR
LQGHEKEMKGQVNKFQELQLQLEKAKVELIEKEKVLNKCRDELVRTTAQYDQASTKYTAL
EQKLKKLTEDLSCQRQNAESARCSLEQKIKEKEKEFQEELSRQQRSFQTLDQECIQMKAR
LTQELQQAKNMHNVLQAELDKLTSVKQQLENNLEEFKQKLCRAEQAFQASQIKENELRRS
MEEMKKENNLLKSHSEQKAREVCHLEAELKNIKQCLNQSQNFAEEMKAKNTSQETMLRDL
QEKINQQENSLTLEKLKLAVADLEKQRDCSQDLLKKREHHIEQLNDKLSKTEKESKALLS
ALELKKKEYEELKEEKTLFSCWKSENEKLLTQMESEKENLQSKINHLETCLKTQQIKSHE
YNERVRTLEMDRENLSVEIRNLHNVLDSKSVEVETQKLAYMELQQKAEFSDQKHQKEIEN
MCLKTSQLTGQVEDLEHKLQLLSNEIMDKDRCYQDLHAEYESLRDLLKSKDASLVTNEDH
QRSLLAFDQQPAMHHSFANIIGEQGSMPSERSECRLEADQSPKNSAILQNRVDSLEFSLE
SQKQMNSDLQKQCEELVQIKGEIEENLMKAEQMHQSFVAETSQRISKLQEDTSAHQNVVA
ETLSALENKEKELQLLNDKVETEQAEIQELKKSNHLLEDSLKELQLLSETLSLEKKEMSS
IISLNKREIEELTQENGTLKEINASLNQEKMNLIQKSESFANYIDEREKSISELSDQYKQ
EKLILLQRCEETGNAYEDLSQKYKAAQEKNSKLECLLNECTSLCENRKNELEQLKEAFAK
EHQEFLTKLAFAEERNQNLMLELETVQQALRSEMTDNQNNSKSEAGGLKQEIMTLKEEQN
KMQKEVNDLLQENEQLMKVMKTKHECQNLESEPIRNSVKERESERNQCNFKPQMDLEVKE
ISLDSYNAQLVQLEAMLRNKELKLQESEKEKECLQHELQTIRGDLETSNLQDMQSQEISG
LKDCEIDAEEKYISGPHELSTSQNDNAHLQCSLQTTMNKLNELEKICEILQAEKYELVTE
LNDSRSECITATRKMAEEVGKLLNEVKILNDDSGLLHGELVEDIPGGEFGEQPNEQHPVS
LAPLDESNSYEHLTLSDKEVQMHFAELQEKFLSLQSEHKILHDQHCQMSSKMSELQTYVD
SLKAENLVLSTNLRNFQGDLVKEMQLGLEEGLVPSLSSSCVPDSSSLSSLGDSSFYRALL
EQTGDMSLLSNLEGAVSANQCSVDEVFCSSLQEENLTRKETPSAPAKGVEELESLCEVYR
QSLEKLEEKMESQGIMKNKEIQELEQLLSSERQELDCLRKQYLSENEQWQQKLTSVTLEM
ESKLAAEKKQTEQLSLELEVARLQLQGLDLSSRSLLGIDTEDAIQGRNESCDISKEHTSE
TTERTPKHDVHQICDKDAQQDLNLDIEKITETGAVKPTGECSGEQSPDTNYEPPGEDKTQ
GSSECISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRDRKVESL
LNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQELLQRV
ETSEGLNSDLEMHADKSSREDIGDNVAKVNDSWKERFLDVENELSRIRSEKASIEHEALY
LEADLEVVQTEKLCLEKDNENKQKVIVCLEEELSVVTSERNQLRGELDTMSKKTTALDQL
SEKMKEKTQELESHQSECLHCIQVAEAEVKEKTELLQTLSSDVSELLKDKTHLQEKLQSL
EKDSQALSLTKCELENQIAQLNKEKELLVKESESLQARLSESDYEKLNVSKALEAALVEK
GEFALRLSSTQEEVHQLRRGIEKLRVRIEADEKKQLHIAEKLKERERENDSLKDKVENLE
RELQMSEENQELVILDAENSKAEVETLKTQIEEMARSLKVFELDLVTLRSEKENLTKQIQ
EKQGQLSELDKLLSSFKSLLEEKEQAEIQIKEESKTAVEMLQNQLKELNEAVAALCGDQE
IMKATEQSLDPPIEEEHQLRNSIEKLRARLEADEKKQLCVLQQLKESEHHADLLKGRVEN
LERELEIARTNQEHAALEAENSKGEVETLKAKIEGMTQSLRGLELDVVTIRSEKENLTNE
LQKEQERISELEIINSSFENILQEKEQEKVQMKEKSSTAMEMLQTQLKELNERVAALHND
QEACKAKEQNLSSQVECLELEKAQLLQGLDEAKNNYIVLQSSVNGLIQEVEDGKQKLEKK
DEEISRLKNQIQDQEQLVSKLSQVEGEHQLWKEQNLELRNLTVELEQKIQVLQSKNASLQ
DTLEVLQSSYKNLENELELTKMDKMSFVEKVNKMTAKETELQREMHEMAQKTAELQEELS
GEKNRLAGELQLLLEEIKSSKDQLKELTLENSELKKSLDCMHKDQVEKEGKVREEIAEYQ
LRLHEAEKKHQALLLDTNKQYEVEIQTYREKLTSKEECLSSQKLEIDLLKSSKEELNNSL
KATTQILEELKKTKMDNLKYVNQLKKENERAQGKMKLLIKSCKQLEEEKEILQKELSQLQ
AAQEKQKTGTVMDTKVDELTTEIKELKETLEEKTKEADEYLDKYCSLLISHEKLEKAKEM
LETQVAHLCSQQSKQDSRGSPLLGPVVPGPSPIPSVTEKRLSSGQNKASGKRQRSSGIWE
NGRGPTPATPESFSKKSKKAVMSGIHPAEDTEGTEFEPEGLPEVVKKGFADIPTGKTSPY
ILRRTTMATRTSPRLAAQKLALSPLSLGKENLAESSKPTAGGSRSQKVKVAQRSPVDSGT
ILREPTTKSVPVNNLPERSPTDSPREGLRVKRGRLVPSPKAGLESNGSENCKVQ